SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_19494 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GS_19494
Domain Number 1 Region: 1131-1251
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000356
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GS_19494
Sequence length 1256
Comment GS_19494 GS_19494
Sequence
SLIGCDRYLSEGRLVREAVNSGLHDDFGSRGGYGSNQGAEEDRFAATADSAINSDITTTS
ANVEHMSHRDSTGSLHTALDNVYGPTKGRSADSTIGDGSSLCRSRTTSMGGNIPRSVHRR
SRSGSLGSGHSALSHRSFCRNTCGHETVDRMNEGRGICSNEVISEWHSIATKNHRASACG
SLNEGNERAIGMDVVGDTRGNEDLSKLLSARIAMHSTSTCSMGSESVFDKDELDGIQNDS
SNIVDGSAGAADKAGDQAVIDMNSEAGVTLLLSTSCVSSAKSNINQRTHISVLNLPVACG
DRGDHIGSRPHSAAEVTLKIDDEDNLLSNTESMGNDVPSYELTKVSATRSGISSTASAED
ASFVSLTCDEANSKVSAAGTPSKSYNEGHILMKESGTPLMMRGDSFSNTPSSALNRTLYS
RAEFEQRKAAIIEATMQQKRDSHSAWPLVYPFGSSDGSSQQQQGSILYHSPSPPRPLYKP
KKPIQNFGTDVYNSKNRFKEESMEERHLESRSASMSNDNQRASRTPSHNSSSDYSTRIRS
DHVASHSSISSSTRDPHIYYERVRSSKPTGHTSECPECTAEVIGESRGRDNMEHSLAALS
DEISAIRHHVSRGQTRRLASLFENMVASTAGDAGLPSLRRNKSLPPPKASHEPYQHQEML
EKQSLDDSFLNERRQEGMKLCAKVPAHRAFESGDKRFFDWDSELAACKGNTKNANVRSLA
DRFEVASTNDRHSGPLKSVNIRPAAQEQTHSRCVTAQHEISDSVMATSGSKHPSKSYYMK
EMMKGKASMCDRYDELLVGEGNSSSFWRANDPSGVIEKRTGSCTRRLQGADKMLKDERLV
TPQMADSAKVEGVRGPTFDAVDKGALGRSDHNLSSVSMSTIGEMNDDADYATRIRGIQEA
IRAQESRVSEVVNSVTAFGKNNVRKFAKIYVQRELLLCRERRSTLLNELKRIEALKAIKK
RTPQLSTTVQSTFDVHSITVQLCKDFCRRSTGEKDSYAFLALLKTDEQVYASDAVSLIDS
GVGTVRFSNHVRFDALPVDFAVTIDIYTMKIPEVRRGAEPFSARTSHKVNDTNLPYSHSK
KSIFDIPLLKSCEFWRCGVVLMNRNKVGIKQLFLDSAEYPLEDVIEVKSHCSALPPILAI
NFGGFLNMMETVVEETSWTRYWAVLHRGTVSFWMHPDEQASDKPAVASLDLTKCINKKIT
PTAYKNKSLNMFVLDMLFDSALCVIEEKRVVLSADTEEFCIAWTQAINETLGILRA
Download sequence
Identical sequences GS_19494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]