SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_22717 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GS_22717
Domain Number 1 Region: 183-413
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.13e-55
Family Voltage-gated potassium channels 0.00066
Further Details:      
 
Domain Number 2 Region: 46-149
Classification Level Classification E-value
Superfamily POZ domain 1.44e-29
Family Tetramerization domain of potassium channels 0.00000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GS_22717
Sequence length 601
Comment GS_22717 GS_22717
Sequence
MASVAAWLPFARAAAIGWVPISRQPMPTAPIAIQAKDLAVDHVSDEKLSINISGRRFETW
RNTLEKFPETLLGSNEKEFFYDEDTCEYFFDRDPDIFRHILTFYRTGKLHYPKHECLVAY
DEELSFFGIMPDLISDCCYEDYKDKKRENQERVMEERLDTADKAKRTLSLQQKMWAAFEN
PHTSSVALVFYYVTGFFIAVSVLCNIIETVPCKYMADDATVSCGDLYERQFFVLDTACVI
IFTVEYLARLFAAPDRCKFLRSIMSVIDVVAILPYYVGLGLTNNKDVSGAFVTLRVFRVF
RIFKFSRHSQGLRILGYTLKSCASELGFLVFSLAMAIIIFATIMYYAEKKVTDTRFTSIP
AAFWYTIVTMTTLGYGDMVPATIMGKVVGGVCSLSGVLVIALPVPVIVSNFSRIYHQNQR
ADKRKAQKKARLARIRIVKNASGQALFSKKKAHEARMQAFEEGTLSLDALKDEDIFEIQH
HHLLQCLERATERELVETDIAFDGGMKPTPPLSLSTSHENLHSSGTRAGFIGCCPFRIGR
QRDCGVGHVSFVTDTDDRPADAGGGGRDEWSSRDGDQRTHLPFKRHIAEGNAPTNICISS
L
Download sequence
Identical sequences A0A0M3IHS1
GS_22717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]