SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GS_23346 from Ascaris suum Victoria/Ghent

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GS_23346
Domain Number 1 Region: 181-208,252-451
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.05e-52
Family Voltage-gated potassium channels 0.00084
Further Details:      
 
Domain Number 2 Region: 37-141
Classification Level Classification E-value
Superfamily POZ domain 9.94e-22
Family Tetramerization domain of potassium channels 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GS_23346
Sequence length 486
Comment GS_23346 GS_23346
Sequence
MSTLAKQINSLLNVRILQRFQWIIAAHSSPCTSDDAFFRLNVGGKSYRIRIETIQQKKEN
SLLNTLISGDHSQRMAIVDAYIPETGEYYIERNSKFAEHILDYYITGLLHKPNDVCVERF
KEELQFWNLYENQIAPCCTIRNEIPEEEVPNKTEYDYLAGSRCGKTRRALWKLVEDPQSS
LAAKLFAFLSIMFVFVSVIGLVLGSMPEFQEDPSNAAAYHLLHYGTRRDEQPPKFDPSSE
IGQQFPHFIYRPTDNPNSFLITVEYTCMAWFTLEYIIRMLIAPRKMTFFVQSLNVIDLFT
ILPFYLEVGLPFFGIQAEKIHELTGAMLVVRVLRVLRMARVFKLARYSTGLQTFGSTLQS
SVAELTMLGMFLVTGIVFFSTIMYFLEKDEVGSEFYSIPAACWWCVVTMTTIGYGDSIPQ
TSIGKMIATSASVCGIIVLAFPISMIVEKFASAQQRAIEREAAKQGKHQLLFLHNCVAEP
INKKFT
Download sequence
Identical sequences GS_23346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]