SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00000560001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00000560001
Domain Number 1 Region: 109-276
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.39e-18
Family MAM domain 0.0068
Further Details:      
 
Domain Number 2 Region: 3-56
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000744
Family MAM domain 0.021
Further Details:      
 
Domain Number 3 Region: 69-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000117
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 4 Region: 328-367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000925
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00000560001
Sequence length 438
Comment pep supercontig:AMS_PRJEB1171_v1:HG380759:497103:498865:-1 gene:GSADVG00000560001 transcript:GSADVT00000560001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTLIWSLKGSQGKDWLQGIAYLPTCASQFNIIVEGIRGTSFTGDIALDDFRFEQCYEEP
VVTPTCAAGDSTQFMCQSRHCVPQTSKCDYELDCCDGSDEEDYVCYDYHRCDFEQDSCSW
ETTSGSELIWERYRTIALLYQQRPPYDHTTRSHLGHFYLLRLNATTPRDSFAAISTYLAP
TVDQGCTMRFWIYFKSSYNGQLLVNYRYEIGGDMKSLAISSYTSCPTNSTRCSWQRIDVP
LSAVLISATEIMIGVKTGADRDAIMAIDDITFTPQCSKYNGTIPTKPTPTPYTGSSTTTT
TTTPGSTTTTTYTGPPTTSTVTTTTTPSECAQYTCYNHGICKPSPTEVGKPMCECKPGFT
GPQCENKEPPKKKSNVGAIVGGIFGAIAAIALVVLGYIFVLPRIRAARDRASLPLMGAQA
LGPITNPAYSETAASSDT
Download sequence
Identical sequences GSADVT00000560001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]