SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00000561001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00000561001
Domain Number 1 Region: 722-877
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.14e-42
Family MAM domain 0.0016
Further Details:      
 
Domain Number 2 Region: 2247-2419
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.01e-41
Family MAM domain 0.0017
Further Details:      
 
Domain Number 3 Region: 1390-1552
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-41
Family MAM domain 0.00085
Further Details:      
 
Domain Number 4 Region: 335-494
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-37
Family MAM domain 0.0014
Further Details:      
 
Domain Number 5 Region: 1047-1206
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.7e-36
Family MAM domain 0.0014
Further Details:      
 
Domain Number 6 Region: 880-1041
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-35
Family MAM domain 0.00083
Further Details:      
 
Domain Number 7 Region: 1613-1773
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.39e-32
Family MAM domain 0.0021
Further Details:      
 
Domain Number 8 Region: 1225-1386
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.39e-29
Family MAM domain 0.0064
Further Details:      
 
Domain Number 9 Region: 552-713
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-28
Family MAM domain 0.0022
Further Details:      
 
Domain Number 10 Region: 1829-1986
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.01e-24
Family MAM domain 0.0012
Further Details:      
 
Domain Number 11 Region: 119-282
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-23
Family MAM domain 0.0055
Further Details:      
 
Domain Number 12 Region: 2041-2198
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-16
Family MAM domain 0.019
Further Details:      
 
Domain Number 13 Region: 1781-1822
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 14 Region: 2006-2041
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000877
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 15 Region: 7-81
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000237
Family MAM domain 0.015
Further Details:      
 
Domain Number 16 Region: 81-120
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000089
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 17 Region: 295-329
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000013
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 18 Region: 2437-2477
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000471
Family LDL receptor-like module 0.0036
Further Details:      
 
Domain Number 19 Region: 2209-2242
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000126
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 20 Region: 515-552
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000236
Family LDL receptor-like module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00000561001
Sequence length 2569
Comment pep supercontig:AMS_PRJEB1171_v1:HG380759:498889:508748:-1 gene:GSADVG00000561001 transcript:GSADVT00000561001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNTVGAQLNVYIRDPRSDVYSTIWSTDTIHGSFWVLQEVTVRPNMTVNGTNTFTIVYEG
VIGSKIGDLAIDDLSIRSGTCQSTTPPQNMYKCLDGTLIPKTKVCDFIVDCKGGDDERSC
GNCTFEGTANQLCGWSDISKGTLKWTRGSNETLLGAGQGPPFDHTTYKSDGNYIYLTQGN
GTTPDAPARFITPVLREASTTCLLEFWIYLTGTSASQLTVTLLTGNQIERATLQRFHYKS
MTNWTKVNIEIGRVDVPFQIAMDSRRTSTYGWVAFDDTKILHCHLPPIVNITKCQEADRF
YCSRGSCIAKSRICDMTDDCGDHSDESTRLCASYQTCTFDISFCDWKHDNTTEFKWELVR
GASPSDDTGPNRDHTTGYATGQYALIEGSYPQTPGQKARLISRPFEPKIAGCRLVFYYHM
FGIDMGELNIYVRYFSNGPLDKVFGVSGERGNAWIRHELKLNYTTPFQVLIEGVVGSSFL
SDIGLDDTIFSPECEPSPLSDLPETTTIITTTPKVCPVADQVHCPGTDICIDKDKICDFT
ADCPDASDEDRCGPCNFEKDDCGWEDVSWTYYTWSRVRASDAVSISSHAPAYDHTLNNAA
GWYMHVAGDMGDFTDLAELRSPALPVSSPECQMVFYYWLVGNSTGTLEVYSSSNKSALWK
QTSAPANRWNRATVNVGANRAGWRIYFELEPNLDFFGIWTDDVAIDDISFTKCSTNRSRH
ILDCDFETDFCSWETKGLADFEWTRISSQTPSVATGPPGDHTTGTGSYVFIESSLPQKPG
DRAWLRSPMIPPALTNCLNFYYHMFGADIRTLNVMIQTPSSNLTVFTRNGPQGNIWRLGQ
VEYHSTQSYQVVFEGIVGKSFDGDIALDDIELNVGECPTTIECTFEHGLCAGWEHDPEGD
FNWSRGRNGSTPSGTPTVDHTFSSVIGHFMYIDATGRLQGDTAYLMSPSYKGSQPRCLRL
WYHLFGADQGILQIQQKPEIGRAKTLWTRLNNQDNIWRQARINIPPLLGMSTYKILIAGI
VGAKPTGDLAIDDISNSEGECPGSEVCTFQEDFCTWTNGENGVVDDFDWLRNSGETPSYG
TGPSVDHTFGTPEGMYIYIEASDAFNTSHKAWLISEHYDAGPHCLVFWYHLYGPDIGTLN
VYSRIGTSQPQLEWSLNGDHGDQWRMGAVNVNMAAEFYFIIEGVHGGDYRGDMALDDILV
MTGSHCTIPTTTTTRAPVTTIGGHTPLSCNFENDTCKWTHDLTVSGKWSRHQGQPSDFHT
GPHYDHTLQTQDGWYLDTSDLKSNQTARLISTMTSIPTRGICFRFWYRAYGSRQGKLNLL
QKASNEQNATLVYSLRPNLDIDWREAIIYRETYGNYQFILEAIVGFVVADSDNIAIDDIV
TKEGPCPVQRFCDFESQDICGYTYDPSGTFNWTRNKGKTESWYTGPPYDHTTFTAEGYYM
YIETSYPRQPGDIARLISPTFPASKEYNCLQFYYHQLGADVDTLNVYKRDVGGSLVPSKL
FTAKGDRFNEWHVQEINIVAPRPYNIIFEGIVGKSFEGDIAIDDILMKERACPELGNCRL
MLDDFELIYGACPVLPSNCSVRCDTITGTQQCIPTSQVCDFNKDCLNGADESACGYDCTF
ERDQCKYTDPSAGLYKWRRQRAGLNTGGTSSSPPIDHTTFSANGYYMIVSTNNGTIDDQA
HLISPILQQSSSTCEVAFYYHMSGVNVGRLEVLLIEGLEKSRLWSIEGNQGDRWRKAVVK
VGRLYRPFRIRFDARKTATTLADITIDDVEWIGCNLPIINNETATCDSTQFQCKRGGCID
QSRVCDYSDDCGDNSDEEKTLCTRPTVAPGCNFETDLCKFSNEYNTELKFERARAFQLVD
EYAPERDHTLNNLAGSFVYVNTIGQDVGRSGRLKSSRIIPTNGCKVRFYYYMNSATSAGE
LTFMIRNLTAGQTTYLWSTSKVLGDHWERQEVFIPTGPKYELLIEVRSLGGGGYIALDDI
SFSSQCTHTDQYLDYGTTTKPTGTTTRPVCAFQCKDGTCITKEKRCNFVADCSQGEDEMD
CGQCDFETSTCGWKDESTGFYIWARRNASSISLMPGDLTTNKTSGFVMNIAGGAGSFAGG
SRLESERIASTLASCHVIFGLYRNRDKDGTLSLYLEDDNQYSTRLWTDPRTTIGRQWSLV
RVSIGRRRTGFRMVFISTHGGSTISSDISIDDFKFEDCGSQGPIHCESYPDPFNCSNGNC
IHQDNLCDYSDDCGDNTDESVCDNYVAMCDFENHADPFCSWSHDTDADFRWQRVRGDQIN
NNNWYDDFWQIYGPDRDHTLGTSKGHLLYLETSSPRKPNDTARVISPVFAPTTSGNCHFR
FWYHMYGYDIGALNIYTRSNVGGKLNLLWSQTGEKGDEWLRRKLVLNSAQPFQVLIEGVR
GKGYEGDIGVDDISFTPSCTLQTQSTLPTTVPPVTGTPPCNATHSQCLTTTSQCIPNDAF
CNFYIDCKDQTDELACPLACNFEQKSLCQWTNDXKNFNGILVVVIQHHLIQVQVMIIQHI
VSTEHISIWKQVQVLLVIVLVLSVHCTVNHQKLACSHSGIICLVRQSIH
Download sequence
Identical sequences GSADVT00000561001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]