SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00000562001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00000562001
Domain Number 1 Region: 2438-2594
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-48
Family MAM domain 0.00051
Further Details:      
 
Domain Number 2 Region: 2940-3102
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-45
Family MAM domain 0.00014
Further Details:      
 
Domain Number 3 Region: 3520-3681
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-41
Family MAM domain 0.00049
Further Details:      
 
Domain Number 4 Region: 1409-1572
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-41
Family MAM domain 0.00081
Further Details:      
 
Domain Number 5 Region: 2096-2258
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.96e-41
Family MAM domain 0.00095
Further Details:      
 
Domain Number 6 Region: 282-447
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.22e-40
Family MAM domain 0.00055
Further Details:      
 
Domain Number 7 Region: 1246-1405
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-39
Family MAM domain 0.0088
Further Details:      
 
Domain Number 8 Region: 4393-4560
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.22e-39
Family MAM domain 0.001
Further Details:      
 
Domain Number 9 Region: 2598-2756
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-38
Family MAM domain 0.0018
Further Details:      
 
Domain Number 10 Region: 3884-4051
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-38
Family MAM domain 0.00081
Further Details:      
 
Domain Number 11 Region: 982-1141
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.22e-36
Family MAM domain 0.0023
Further Details:      
 
Domain Number 12 Region: 450-613
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.7e-36
Family MAM domain 0.0017
Further Details:      
 
Domain Number 13 Region: 1576-1739
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.28e-34
Family MAM domain 0.0026
Further Details:      
 
Domain Number 14 Region: 4207-4368
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-34
Family MAM domain 0.0042
Further Details:      
 
Domain Number 15 Region: 2274-2435
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-29
Family MAM domain 0.0043
Further Details:      
 
Domain Number 16 Region: 820-979
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-28
Family MAM domain 0.0018
Further Details:      
 
Domain Number 17 Region: 4563-4721
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-27
Family MAM domain 0.0046
Further Details:      
 
Domain Number 18 Region: 1769-1918
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.81e-27
Family MAM domain 0.0012
Further Details:      
 
Domain Number 19 Region: 648-815
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-26
Family MAM domain 0.005
Further Details:      
 
Domain Number 20 Region: 107-277
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.18e-25
Family MAM domain 0.0032
Further Details:      
 
Domain Number 21 Region: 3317-3473
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.49e-25
Family MAM domain 0.014
Further Details:      
 
Domain Number 22 Region: 3106-3275
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.04e-23
Family MAM domain 0.0014
Further Details:      
 
Domain Number 23 Region: 3714-3872
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-22
Family MAM domain 0.0068
Further Details:      
 
Domain Number 24 Region: 1929-2091
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.06e-21
Family MAM domain 0.001
Further Details:      
 
Domain Number 25 Region: 2776-2937
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.96e-20
Family MAM domain 0.0047
Further Details:      
 
Domain Number 26 Region: 4054-4204
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.96e-18
Family MAM domain 0.013
Further Details:      
 
Domain Number 27 Region: 3479-3516
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 28 Region: 3287-3317
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000759
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00000562001
Sequence length 4738
Comment pep supercontig:AMS_PRJEB1171_v1:HG380759:509010:528496:-1 gene:GSADVG00000562001 transcript:GSADVT00000562001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDKSNKLSVFVDKQYTWRSRLLQGQSRTQVQLNISSQIAIGSSRTATLIAFDGQLQKNA
QIQVEDIMINHQACPSITKRSISKRSTQTMSASRSRTIRSVTSKAVAGYDCTFEQDHCGW
TQGQNVTIPWFREQAASNSLAGVVGPLYDHTYGNATGYYVTARLEIPVINFNDIDISELV
SPRLPDNIASPMCVDWWYMMHGTDDTEFNLNFVINENFASAKSAWRRSGDQGRHWQHGQI
QINPGDQITRVVYEVVALWSIRSEVSLDDLTLVDGPCIQPDFYSIDCTFEEEHICGYSSD
PSGQFAWTRGQGTTPSSQTGANQDHTLGTALGHFMYIESSSPQRPGQKARLLSVVEQPEK
GRCLEFWYHMYGRSVGQLNVYTGTNTSANSTMTLLWSRGANVGDVWRKAHVSTEYTTPFR
VIFEGVIGNGFEGDISIDDIKRLSVSCQEPNNCDFEDDTFCGWENVKTDQFDWEITNGPS
SASLASGPLYDHTLGTSAGSYAYIDTNKNRKTNDTAILISQSMANAGSNGMCLEFFYHMY
GPGIGRLTAYLQLEGFQPLAMWTLEGEQDDDWFQGKVGFAVSSDHSVLIEARVTLNNHGD
IGLDDISIKNGYCNTLPPYAIPQDGLSTASTSPTTKVLVKEMIFFHSYFDCDFESDKCPL
WSITAKPELTWTRVQGATASQDDQHNPLYDHTGNQVQGYYLLLTPTKSTPFPDTNITSQY
RSTQMSNNRQCLEFWYFMYGSHVGSLNVEKLSNSFSQLRWTTFGGKGYEWYHAQVNLQSS
TSNPATFSIVIEGIWSGSNRGSIAIDDITLLNGTCRTSTDQCDFDSDDSICGFQYDSTGQ
FNWIRGLASVVQAGVNPNNDHTTLTDEGYYMVAEGKNRNANDRARLLTPIQDRTSGSCLH
FWYFHHASTKQMNLNVFLASAGPILWSHDGSLENRWLYAQININSPSQSWQAVFEAEVLT
QNPDASASIDDVSITRGLCPKPGDCTFESDLCGWINDDIDVEMDWIVGQGIHSFGTGPQY
DHTTNTAQGKYLMIETSWPTQQGDRARLKSVVFDSTNGDARCFRFWYHMYGDSIGTLNVY
LFNSSFTRIWSLSGNRGNMWYEGQVSYVSSVQHQILVEGIAGKDFLGDISIDDFTFTTSN
CSIRPLHDAVPTIATTIPPTTTTTRTTVAPQSPWDCNFEQGVLCSTCQLGRVDVNITTDK
DTSMIWSFGTVDQGDSWLFASVGYYSDEDHANKNSRKISLLVPSIYDCTFEVDFCSWTHR
SDAALNWTRNRGSTSTFETGPQFDVTTHTDQGWYIYLETSSPVILNDTARLQSPSIPGST
PKCFEFWYHMHGPDINRLDIIAIDSSNQETTVWSREGTQGNVWRLGKVKLNDITDEYSII
IQGVAGNNYQGDIALDDLILIDGNCPSDLPLECDFDDAGICGFTHDITEKHQWLRHKGAT
PGSLSGPSIDHTTQSVNGYYMYTPSASSIKAGEKARLMSPWMNDTDGQCLSFWYHSFGVD
VGALTVYKRVASSDNLYPIWKVNYNFGDIWNAAEITIRYTNEPYAIVFESEYGIGYFGDL
AIDDVLIKNGACQVIGSCSFESIDFCTWHNLRAPLDEFDWLIGHGQTDSAFTGPSVDHTY
NDQFGFYAFIEASHPRVPNDRAILESTILMPTSTIGSCFSFWYHMYGSIGAINIYINGVK
SLEPKWVWTQKGNKGDQWLNGQVTIRSSSYLRLRIEGVIGDSFQGDAAIDDLRIFENPCV
VTPADADPELFPPTTTTTTVPTTTNPLGPYDCTFETDSCNGWENMANNRFNWTRVQASTV
PAPSIDHTTHTGQGYFMQANLGQRQKNDFARLKTPLLSNLQCMTFYYHLYGHGGTLNLYM
ALGNNLGIPIWTRVGSQGDVWRFEIEFKRSFHLLHFLKALAGTNAIGGVSIDDVIFNXSG
ICRESAAIGESCTFTDVSQCGFTQNTTSSTLQWKTYSGGNEVLRTTPIPYDHTTGTNRGS
YVYIDLENQGENLNGRLYSPMYASTMTETYCVEFYYVLVGSNTSFHVYTESNTGTKRTIF
TRSYDHGLAWIKGEASVTSPSEFRIVFETITGFFRQGFVALDDYTYKSGECGFRQNECSF
DDGSLCSWTNAADNQFDWLAQKGTTVTSSTGPNGDHTTGNGYYLYIETSAPALLGWKARL
ESEIYLDNGPRCFSFWYHMYGRDIGRLSVYLRSIATNNFTSESLVWVLAGPQENNWKHGF
APIQPNGRYQIVIEGVRGKSFEGDIAIDDIGVITSDSCTLQPVDADPIQVSQQAISCGFE
NNFCQWQHDPTGKFNWTRHTESTPSVDTGPSTGADNTPYYIYIETSYPQAQGDRAGLISP
VISKAKSDMCFQFYFHMWGAHIGSLQISALQNTPTGQQQILLWERNETQAKEWRVAYLNL
RDIPYDFALKIDGFVGNGWEGDIGVDELFLLDGECPPSVWCDFETSFCGWTNDTTGDFYW
TRARKATDSPSTGPSTDHTTGTDRGYYLYIETSSPQKPGDKARIVSPMYAASSSVCLKFH
YHMYGASIGTLNVLMANTKQLLWTKSGNLGNRWRYGHVTVRSNSPYQVAFEGIAGSSFQG
DIAIDDIMIANGPCEDEGSCTFEDGTFCGFYNTKEEDNFDWTLNQGETFSENTGPIIDHT
TGTSAGYYAYIESSLPQKLGDKAWLVSEVVESPKGACLDFWYHMKGDTTGNLTVLHRIMD
KQPTILWSKEGDQGDLWLNAKVDLPVTNDHYDFIFEGVVGDGHESDIALDDISLAQAGTC
AFLASTTQAPVTPQTAAYECDFEDGSFCDWQVETDQKWIVSSGQTAVYGKAPLIDHTRQN
IHGKYAYVPIEGNGGPVYFATLGIRSLPRGVTFCLDFWYQSFIPSTTMLNVYMQNGTSKA
EFLWSRPGTTVRDQWTHTSINLGTIRGAAHVTISAVVVPSSTGYVALDDLKILNGVCPSP
RVCDFEDASICGYQNDATADFSWSRHRGSTTSSATGATNDHTYGTGIGYYMYIETSSPQK
QGDKARLITPEYKVAAGGSCLQFFYHMWGASTGALNVYLKVGQTLEGRPLWALSGDQGNF
WRPARATIKTTGKFQVVFEGVVGPGYTGDISIDDVSISSGPCSPLGSCTFEQDLCAWTPS
DGKNDFDWYRLSPKQIGLLYNNSNYPSTDTTINNAYGHFLWAASDFRSNRANQSSSLYSE
ILLAYQYQGGACITFSYFLSNSATLNVYSRARPANQNSTLLWTQSDDHYDYWIQEEIDVP
VIASDFEIFFEGIFNPSVSTSSVALDDLHIHSTPCSQIESTPSPLIPFDCGDGTTIPQSS
VCNFITDCDNGRDEQECADCTFEQGTCRWLDISIGPFAWARDQGNNVAPLHLGPVVDHTT
HTGRGFYMYVKQSDGLFWDDATFELQQVLQQSSAGCVLEFWHHMLDHQFLSVHLLEGDTS
IEIWEEDHAHGDQWEPVTIPLGRISRPWRLQFLAEKSWGDGTVAIDDVRLYNCRFPPVRP
NCTDNQFRCTRGACVSLDRVCDFTDDCGDNSDELNCQNNIMCSFEEPTGMCDWTQDEDND
LDWELGQGETESYKTGPKRDHTLGLPSGHFIFLEASSPAKEGERARVASPVINSTGFSCE
FRFYWHMYGENIGALNVYTRSTYGGEMSKIWSKKGEVGDYWTRTDLPAILGKPFQIVLEA
IVGDGYAGDIAIDDTSFTSGCVLANVDLVTVTTPIPSTTTPNPCAATGQFMSECGTCTFD
NNNGTLCGWKDYSYGNLQWKLTTGKTDLGPSSDHTTGSGFYVSVPASDSFSFASMRTPAI
GPTGVECQLKFWYYLDYDQSTASTRIAIYIRPESNNFTTFSYIATVDEPTGAQWKQATVD
IGGRSERISIEIDGSPREFNAVAIDDIEFYNCQVSAPPQLGLLIDCTFEHGWCNFFHDES
ADFEWERSNTATITSNTGPGFDHTTGSGYYIFIESSWPRVPNDRARLLSGYQNPTSTPRC
LTFWYHMFGADIGALNVYLQTLTTTSSSVSSTLVWTKSRTQGNIWRRATQTLRNLNTTNM
YGWRLAFEGVVDKSYQGDIALDDIFVSQSECPASRTCNFELDLCDFQSTPENGWIRQQAT
NLSNFINEDHTSGTSLGYFAMATQDNAKLRSKQYPNVGDECLKFWYFVNGPDGATGILSV
AKQNSGSSIESTLWSNDIYVNEWRYEQVTINGLRDPFYYMFQASKSSPDVVIGVDDVILT
LGSCSPPINCDFEGPDLCSWVQMKDNTFDWLLQSGATDSFGTGPLVDHTTNSAQGHYIYI
ETSSPTKPNDTARIISEHLLIGQGCFSLWYHMHGEDIGSLVIYTSTKANPKTEVNRINGE
QGNLWKKLNTDIAVTLQNREWVRIIVEGIAGPSFQGDIAVDDITWSPNATCQSTDTTAAS
TTPSVPTTYPPTIYDCDFECNCTCQWKHDETLPFKWIVRKGSTSSIDTGPEADHTTGSRQ
GHFIYIETSSPATFNDTARLISPDLIVVNDDQCFRFYYHMFGSDVYRLNVYARINGNLGK
ALWQKEGNQGNQWLFGRIQLRGNVEQAVGQPFQLVLEGIVGTGFRGDISLDDLAVNNGPC
PISTVCDFESSDLCGYVNDPTNTIDWIRHQAGTDASIPATDVSYGSSHGHFMFLKGNDAT
KSLSGRFVTPSYPDTSGSCIRWYMLLENTPTLRVRTFAFGSLNPNILYTIHGTQGTQWKA
AQITVRSGSPYQVVFEGLLNNTNSMLDSIALDDVSIRSGACDXXXXXXXXXXSVVINI
Download sequence
Identical sequences GSADVT00000562001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]