SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00001021001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00001021001
Domain Number 1 Region: 208-239,275-454
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-41
Family Voltage-gated potassium channels 0.00068
Further Details:      
 
Domain Number 2 Region: 85-179
Classification Level Classification E-value
Superfamily POZ domain 1.02e-23
Family Tetramerization domain of potassium channels 0.0000616
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00001021001
Sequence length 649
Comment pep supercontig:AMS_PRJEB1171_v1:HG380760:684191:686358:-1 gene:GSADVG00001021001 transcript:GSADVT00001021001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQNIQQTCTIEPIEQIHSQSERTSTNQRRPFERLFERSISVKQPYLASRSTETYVSDIIN
VQSLLNIRAREFVPRQRNNSKSIQDRIIINVCGDRYETHRTTLELYPDTLLGNRRRRKYY
YDKSRNEYFFDRNRACFEAILYYYQSHGRLRRPNYVPIDIFLEEVTFFQLGQVALDQLRK
DENIKEVKKIRLPKNRFRRLLWATMEYPDYSIFAKFVNIFSLLLILTSTITLAIETLPDF
TTLDTFACQKSRQEISYLDNNSNDTNLTISNRITCHSYFTTPFFIIQTVCVGFFTIELFL
RIISAPSLKTYIINIMNWVDILAVIPYYVVIALHVIGRESEIYTTTYVALRLLRIVRFVR
IFKFYHFFIMIIILTLLSFLFGAAAYFAENDTNGVAFDSILKATYWGVITITSVGYGDIS
PITPIGRIISCLCALFGAATIGMLVSVLVDRYQRVYARKLYINEEVVSFDDLSDEENIDN
CSRNNSGVFRRRRSQIKEIENPDARAKDNAAFEMERNITETPDINSLPKTDDVLTNSLCR
NNSRVHFIIGYVDDDQHETSLDLLEKISSVVAQKQTTDESIQLNIISDQSTQPKSQRTSP
YDVRFRVSVSSDEEDTDKDEELTEIVAGHASKGNVLKKFQAPPSPKDTK
Download sequence
Identical sequences GSADVT00001021001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]