SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00001120001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00001120001
Domain Number 1 Region: 430-528
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.98e-18
Family Mannose 6-phosphate receptor domain 0.0086
Further Details:      
 
Domain Number 2 Region: 218-285
Classification Level Classification E-value
Superfamily EF-hand 0.0000109
Family Calmodulin-like 0.057
Further Details:      
 
Domain Number 3 Region: 77-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000511
Family LDL receptor-like module 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00001120001
Sequence length 543
Comment pep supercontig:AMS_PRJEB1171_v1:HG380760:946296:948598:1 gene:GSADVG00001120001 transcript:GSADVT00001120001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVYINLVLISTLLTLVLSGNVEHAILRGIPTSQLPKYVSSKPFSCLDGSSTIPFEFVN
DDYCDCRDGSDEPGTSACPNGRFFCENKGYVGTIIPSHFVGDGVCDCCDGTDEYETKIVC
NNTCFELAQKNQAEREARRALHAAGVAKKLEIITQSVVIKADREERLKEFEQNLQKLESE
LKEKEELKNQAEAPENEAKEKHQKLWEEQRAIREAIARDNQMREMFAELDTNNDTLISID
ELQKHPELDTDHENEFTVDEVRSILGADSVNFEEFNVTVYEQISNSYKKLQEPASEIPVD
LNDIAASTEAYLKQKEDKEVDQQEQEQDQHHYEEETPNNEDDEEHDFDQHENPSPMATSL
EHEKHIHDDTVPEYDDETKRLIQIADQARNEYNEIERRVHDMKREVDDLKRQSDVDVGVH
GEYAAFIDQCYDYEEREYTYRICMFKDAKQIPKGGGGDVTVGYWDSWVGPADNKYLKMKY
SNGATCWNGPARSLTVTFRCGIEHKPVDVREPTRCEYAMIFETPSACDEKIASATLHHGH
EEF
Download sequence
Identical sequences GSADVT00001120001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]