SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00001445001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00001445001
Domain Number 1 Region: 1326-1389
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000311
Family ATI-like 0.04
Further Details:      
 
Domain Number 2 Region: 1426-1463
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 1465-1500
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000982
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 966-1023
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000327
Family BSTI 0.035
Further Details:      
 
Domain Number 5 Region: 1628-1663
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000034
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 6 Region: 488-550
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000834
Family BSTI 0.036
Further Details:      
 
Domain Number 7 Region: 1503-1542
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000838
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 8 Region: 1552-1589
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000916
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 9 Region: 1684-1708
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000144
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 10 Region: 863-924
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000213
Family BSTI 0.04
Further Details:      
 
Domain Number 11 Region: 1590-1629
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000301
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00001445001
Sequence length 1782
Comment pep supercontig:AMS_PRJEB1171_v1:HG380761:787833:794698:1 gene:GSADVG00001445001 transcript:GSADVT00001445001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSYSSLLSALLFSIHLANFLVTAQISGTNICTTTVTETKNNTCPDGSTFNIMAEYEKPA
GIWRIDFNTLRTVQGLKDADEVIRYIKSQSAANASCPYQRQVSKDACCAGWTGESCNVAI
CTIPCKNGQCIKPDQCFCNNDYAGEGCQYQQNDPRLVLCYRTSSCNVPSRISNGTVTASY
CCENLAGVAIGSTDGTCSLCNATNEEIANATAQIKRTLTYATCLLWGRDHFRTFDGFTYN
FQGSCQYKLSGTSSWTVVVQNVNCDQWTTCKKSLSISFGGYIITATGRKVIVNNVALNDN
QGYVDGPLTIERRSGDYTYLRYSDGVRLKWDDGMTVAVTIEQTYMKQVTGLCGTYTNNRD
DDLQLPDGSLSASATHFSNEWRTDSGVSTMKLSYISPVPTDPCTADLIDAAEVACRPIIS
PYDSFKICNRVLNTTPIYETCKRDHCVAAKYGINAQEQAVCSSFEAVGRDCEDNYMHIDW
RTTDRCPKSCENAKIYTECATSCPSTCQNYRQQFTDSVNCKKDCSPGCVCPSGSVIDIGR
NGTCSKVEQCTCRAEGKYYLAGASIKVDCNECKCVTGTWSCTKKYCSRTCSVLGTNHIQT
FDGKFYSVRGNCEYILVEVKDHLFLYIEINPSIGLYVAMTNSYTSTSNYKDLTVKCNQTY
VYIKDKNVQINGEIRAILPYKNAEVTVTRETTVFHTITCRGAQIQFDGIRVYIRLDPTHV
NNTRGLCGTFDFNRDNDFSIRTQIVDTNTQSFIDEYKTSTVCTTPNQDDPCTINGNLQSE
AMSTCSILKSSLFQACASKIDPSPFFQSCQYDLCSDKNSHFQNTFVCAAAAAYARECRLA
NIIINWMSDANLKLKCQDAQYGQCSGGAAYSDCAPKCSQTCHDISVVNQSCYERECMAGC
SCPSQSYLDVSVSDKPQCVPQSGCACYDFETNTYIKAGQTVARSCGNCTCTNGKWNCGSQ
SCEAATTCPETQVYSYNATACVKTCDNMKTWRDCGLTYEGCTCPNGKVLSQDLKTCVDVK
ACPCRYAGRSYGPEQSVKSGCKDCKCSAGSWICTEQKCSATCSASGDPHYVTYDGNYYSY
QGNCKYVLTQTKDLSFRVITENVQCGTSGVTCAKNIFIKCKGLTVSLTRGRDPIVGDVEV
KDLDLGHRVFGDVSLMKSGLFVFVNCSDIIVKWDEKTRIYVTIPYNMKGQTAGLCGDSDN
DPTDDLNTASGVPGTITDMAESWKVEQTCVTGPSPVVDPSAPCAGFEARRNWATKECSLV
KTNPFLPCIEKLDATVVQDYYRNCLYDACHCDTGGDCECLCTSLSTFGEKCQSIEVPVKW
RTQDRCPMQCEYGKIYMACGAICQSTCRDIYLKDDYSCVDSGCHEGCFCPEGQVMDETGT
CVEPDACPCIDNNIPYSVGTKLIRNCDQCTCTNGTFLCVPLPNCVPKCSRNEFTCNSTGV
CIPLSHVCDKISDCDDESDEFNCGCTPNDFICDNGQCVNSTKRCDNLPNCRDGSDEFNCN
ETYPCYGFRCDNGKCIDRSWVCDGHVDCTQKGVFDNSDEHQCNHTECDTESGRAFRCNDN
PMSKCLPIEQRCDTHDDCGDGSDEKNCTCMCTDNKFACTTICDCIPVANVCDGIEQCRDG
SDEKNCLCNINEYTCNGGGCINMTKVCDGVPNCPKNDDETHPNCSNPGTTTSVCTTRLCL
VSNVYHCIPEEELCDGEKDCDDGSDENPQLFPNYPRCTLPPCTQFICDITQSNPLGKCVN
NSRVCDNYADCMDKTDEDDNLCNYTTTLTPSTTTTTPEGLIS
Download sequence
Identical sequences GSADVT00001445001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]