SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00002176001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00002176001
Domain Number 1 Region: 793-860
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 1.7e-25
Family AN1-like Zinc finger 0.00015
Further Details:      
 
Domain Number 2 Region: 10-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.68e-18
Family Ubiquitin-related 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00002176001
Sequence length 865
Comment pep supercontig:AMS_PRJEB1171_v1:HG380763:794919:798110:1 gene:GSADVG00002176001 transcript:GSADVT00002176001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPTNQTTSRTLIPVNIETLAGTSFELLVSPFEQIQSIKRKIERRECIPSSHQHLVFRSN
ELDDELCLNDYNIEAGTTIKLVLAMRGGPVNTKRVPIEDNLIRDMTEYIESSRDDCDLVP
SSSSSNKNVTFLVLRDGDQFNFFQVIDRGDGTLSPLSGSISAASMYNTHETLSVEPEPEY
DQKRRDDDRKMKQKMELIRSKLKTHARKDSLLPPRPPTSSKPTKSNILHHHHHHRRPFPI
EATSTITTPTTEHFSSNSSALKQPQTRSLSYSFSTNIFNPYNLLSTSNINRTNLLHEEDS
EDDDDSPDEEDDDDDDDDDQKLSTQKIFGGRSFSSSIYYQRKHHHHHHHHHHHHHTAKNL
FSQETATTTTATTTDNTTGSSRVLIDYIHRISPTIPIVSTSSRMLSATKCLNTSDEPISS
DEKNDSTNEILYHHSHTSPMLELIDDETISSTNITRKPTADLQSRNETSLSKPIWTDDDE
QINVSDEYIPGERTSTSQSMIFCHQNSSTNITSIPTLPQVIKKSTLPSTSQQFYHHHKPS
NSEQPQLNKTITRPLRPLSLAKYRRISSNVHLSTSLQPQTLIGGATSTNSSNELINNNSH
GLGINRNNSTDSFNEHLMLNKRIEILKTPGKQQPTAPSPSSLSNTNLSPASLPPPPPPPS
KRHFAQQDIKPTTTIPPITTSIPPSRSSSLIPIDNTKVTIETIGSKTVSALLRQNATIEP
VDTSRGVGKHLVSLLTTASKETTSTKXPNYKQPSRDAIIDERFKFDSKLTNSLSSNITAT
TSTSSTCNSNRLPPVIRNRKSTAKCFLCKKKTGLATTYQCRCGSSFCSEHRYPEAHACAF
DYKAEGKRLIERNNPLVTAPKLPKI
Download sequence
Identical sequences GSADVT00002176001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]