SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00002294001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00002294001
Domain Number 1 Region: 1242-1543
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000375
Family Rhodopsin-like 0.022
Further Details:      
 
Domain Number 2 Region: 219-255
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000142
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 984-1022
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000468
Family EGF-type module 0.027
Further Details:      
 
Domain Number 4 Region: 174-215
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000816
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00002294001
Sequence length 1550
Comment pep supercontig:AMS_PRJEB1171_v1:HG380764:82336:87030:-1 gene:GSADVG00002294001 transcript:GSADVT00002294001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTTQLVIFFLLFFIVDARYILYQLNNRYETHTKYDCLYTDISDYTEDQGVSRLTNYNL
IPYCRQHDMDEEKLLVSTLHENIENQVTFTELYRKNITSARLLEWFVPVDIAEDYEINGK
NSSKIFYNCSSPWFGSTCQYQLLYNTTLMFSDLVHALFHYRLPPPFTKEFLAGTCYPFVT
NCYRGVSTVCLDWREICDGKLDCFNGEDEEFCPVLELNECANDEYRCHFGGQCIPIAYVY
DGATSLDCLDGSDETYKSVFMDALQPFHCLEISTFRCEEYQNRYRYYFSCSDGSYIEQFL
PHFALLPYNYRGLYMSSEMFVTTDYISDMNCRQMVYYTNDLCTNFTMNCSLQWFAWPEYP
TFFGFFQFVYFNNRSIADFEIDLMPDLLCFNASQCPALLFCIEDFQINNRFSCCRRNRLI
EGTIDVWHSIIFGMFKDLILRCRTIGSELTCSDSSLFHCPKSFKCISKHRLADGEIDCYF
REDELYPACQLNDTWRFHCSSETNKCLSFIALEDKRYDCQNGEDELTIDERDIQKGNVPF
ALFCDEYNDIKRTNFSNDTDETHCNQWPCDTPYVRCNHVWNCLNGIDELNCPDSKCSLNE
HICVTEIGFGDHYCTKFSQLKEFYWHTTLSSTFERKLSLISNTYINSTNYFLWNKTKCIT
SKHLLSHESSLPIEDNGVCLLQTQLPPAFRIVTYVENNFFPTDICVLVSKFSEEPIKKRF
LQTSKLSNYPAINTTHNNNNNTLRLVVPNPKVPYIFLEPSTSWYCNRGISIRFSINKTIK
CFCPPSYFGERCQWQNQRVSLTFELIYRMNKFSTPVFQIMIFLINEQRQISSYYEQMIYI
SKQDCDKKFNLYLLYPDQPKNSSANYSIHIDIYDKITLTYWASWYLPIPFQFLPVNRIAT
QLFVPDNPQSKSCSLFCGHHGQCVQYINTNTSYFCQCNQGYSGPQCETSHHCSCSSDSFC
YTSSICVCPIDKFGSKCYLKHLVNHTCENNGISVPLDDRFNMKQFICLCKENFHGEKCEY
NKSRIDIELTDEIIGETKMIYFHYITAFETRAHQRTTILRKVKYNEDSITLLVAQSYHIL
LVELINKMYYVVVLREKFIESEHIQNKLTINQRCLSINELFNQTLRSYSRYHRIKYYPYL
CRQNFKVMCFYDENYMCICDQDRFSNCFTFNRTIKYDCQDENPCENGGQCFQDNVTCPSS
RICSCDDCYYGAKCQFSTKGFVLSLDYILGYHIKPNLSLSKQPLIVKLTIVIIILMFIGG
LINVILSVLTFYRKKTQAVGCGIYLFISSWISIILISFLVMKCVQLIFSQMNLLTNRSWL
NFSCQFLDMFIQVTLTSNDWLYGSVSIERVFTVIKSVKFNKSKSKQLAKWISFSIILFTI
LTHIHIPLYRKLEDDIDIDEKRTWCLIQYSSSINIYNSFINLFHFLTPFTINIISIFLII
ISMARSRATIQPKLTFKQHFQLQFKQHTHHLITSCALILLALPRLIISFITGCMKSPRNS
WLFLLAYLISFLPSMATFIVFVLPSKIYKKEFNDVIERTVRRIRERFTNN
Download sequence
Identical sequences GSADVT00002294001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]