SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00002302001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00002302001
Domain Number 1 Region: 1256-1549
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000146
Family Rhodopsin-like 0.013
Further Details:      
 
Domain Number 2 Region: 559-593
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000034
Family LDL receptor-like module 0.0034
Further Details:      
 
Domain Number 3 Region: 978-1024
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000242
Family EGF-type module 0.027
Further Details:      
 
Domain Number 4 Region: 216-251
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000537
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00002302001
Sequence length 1561
Comment pep supercontig:AMS_PRJEB1171_v1:HG380764:113621:119387:1 gene:GSADVG00002302001 transcript:GSADVT00002302001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNVNIIRIYRHLFTILILWLNSCLNEQYYLYDDDCLDFNVTNYLLSSGMTDREHQIIS
FCRRDELEYDRSVVIEKQIPSVTFNELYMKNISSLQLYNWSVHMDLVEEYQAFYENKMKK
KDLESNMSISSCWIQQKFGQYCQYSFDTQNSFDTIAKDVLKAASSLESNGTCYAHLNCKR
NNSTWCLDWREICDGKADCWPNHIDEHFCEQLEQNECASNEYRCFDGQCIPEMFLLDKTS
ASDCLDNSDEDVVKYADFSFRCFRYSDPTFRCSETRCQHWNTQFESDWCGRWSCKGIKCR
DTLRVQFYRDSLLHTANTHINEKCWATMICLTQTPNCNAFCWEPDISCSQSLIKFCPPLF
EFPAQSIGWSDLHFVYSWNRTGTFSTVPNYICYNEQRCAFSPSNIRFTKISAPTTILSCE
LASATNFQDFWLHQVPTIRTRLQRQCSLAIVINENYCSQPTQFRCGNKCLSKHRLRDNLA
DCVDRADEVKSINSCALKHAHRWECISNMTGKREIKCLPMTHTLQGERGECKIEEKIPHF
PTLCDGHIQHTEVLNGEVKTDETNCEAWQCSNQYTRCDGVWNCPDGADEAECFHVICQGL
VGYPCLLRHTAKYICLPFSNVSDGIVDCLGATDEQQACENNRLHEGKYRCLTNGSNDIQY
VNDVQPSVQDLCSSYWAYDRRLTAHNLICSLDRPMKSPTWSQFKIPQFSLSKYNVVFYYA
RNQQVSSVISKSVSSIDVVQRIPLVINSTSQRTSLIAFQCNGGIPIYSDNDIKCLCPPFL
YGAYCENQNQRISVTLKIGAPEWRVPFVFVIYLFDETYGIVNSYNKLRFVSTRDCNTKFN
FHLLYSSRPKLSNRIYSVRIDLFEMITFKYRGSWLFPILFPFLPVYRLPVYVTVPFVGIS
STINCPLKCHPGHGRCVSFLNTNKYFCKCQTGWTGLKCETSYECNCSPDSICFGTSNNKS
ICVCPVHKFGRRCYLNNTRCEQPDAKKCQNGGQCIPGDMPIHSGSTTTCVCPQSFHGDTC
QWNDTRIDLSIAMPNKKDSILVHFITANMHMRLQPYFPILEWNPHERATTLKKLRFDKNT
VTIYWQHPFHLIFAEYDQNLYLLFTQLTYKASVHLTISLKPRFQCPSIRNLVNSTIVNYP
RLQRIKYYHIPCQEKTKLKCFHDEDHYICLCTDDRRANCFTFDYHSTFSCQQLSYCENGG
QCFQNNAKCPTTAICVCPKCYLGTRCQLSIRGFNLPLDVILGYKIRPNMSFKKQSLSVQI
SGIITILMFTFGIVNGTLSIMTFQQKELQKVGSGIYLFIASIMSISTILIFTIKYFLVVI
TQIRMITNRQFLFGQCVTIDFLLKISLQIGDWLYAAVASERLVAVIKNTNFKKKRSLKIV
KWVVLAILLITIGSSISESLHRQLIDDEDEERIWCIVRQTNFLNLFTSITTVMHFVGPFL
INIISAFGIVYIRAKRRWNFQKEISLNQHMQNQFRRHKYLVISPIGLILLALPRIILAFQ
LECMKSAHESVVFFLLGYFISFLPSLLLFIIFVLPSSMYRKAFKKTIRTYQLIIRRWFYH
N
Download sequence
Identical sequences GSADVT00002302001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]