SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00002374001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00002374001
Domain Number 1 Region: 1235-1523
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000412
Family Rhodopsin-like 0.013
Further Details:      
 
Domain Number 2 Region: 965-1011
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000108
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 216-254
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000772
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 4 Region: 180-213
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000419
Family LDL receptor-like module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00002374001
Sequence length 1527
Comment pep supercontig:AMS_PRJEB1171_v1:HG380764:376400:380983:-1 gene:GSADVG00002374001 transcript:GSADVT00002374001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVIIYLSMLIGILSMAMCQFNMYQIENYYDRYCLLLIEDYIGWVDDHDPNMIPLHETISY
CFRLSEDDNDTLISFFENVTDPVFTFMELKGRNITSEMLLSWSATIDLTEDYEIFLTNNT
SSLLLHKQTFYNCTLPWFGPFCAFNFDDISIQSFNDIVKTSFRVKRKIDKNIQATCYIHL
ACKTLLSCLDWREICNGMIDCLDGSDEKNCWQLEINQCNNNEYRCHNGQCIPIEFYRDHV
SHPDCMDRTDELSSVSLKQCYLNPYFKCEQHMCSPVYDEFPCGDGECTDGINKCSNGRLS
ILLNDYCSTAVSCQLTPEFISGIACLKCQKNNCIKENCSSLFEYQTVPPIFGHVHFLFSN
MINISDGVPLPEYVCYDEKLCENFIPATENIGSYTCRKFNLSEIGSRYSYESFNRIIVDV
KNRFRTCLQMNNNYDYCNNSMMYQCSNSKKCISKQRLVDGFQDCPENDDEEYQSSCSLDD
VRQRFQCIYNDPKKCISFVALHNTKIDCNMGEDETGSFENYKLTHIYFQNICDGEADLLP
IQIDGKYETDETECKDWPCGNIYAKCSPHQKCENRIDRILCSKYDVSSTNGICESFIDNH
DYSCISIDENTVPKNEIISFIDISKYIHCWDNKKSVPYKWFCGQTNFCLLSGFVPFCSYF
QLTNTQLCHDLVSSVHIEGKHNSTCIIRGINQWKSRMYFKVLGMSTFPLNIRNMTGAKQS
FIEKKDRSIKKTRKVIDSSAEAWRCTRGISVRIRIDFNKTRLYCLCPPSYYGDKCQYQNE
RVSITLQIQVLSNWTNIIVFLITLIDNEKHIDSYEYVEYLPSRDCNTKYNRYLLYSTRPK
NSSKKYFVKIDAYDQAILKYRTSWIFPIQFPFLPVHHLPVLLKVPLSIEKPIESNCWPPC
IHGQCHSYINNDNLTQCHCESGWSGTQCNIQHLCKCAFGSLCISDSICLCSASRFGRRCY
LRELSCQSNPCLNDGQCILQDVRYRSQHQNRLTCVCRQGYTGDRCEHQQNQTEIDLSFDE
LEIIPSAVLIHFIFAEENGPPQRNTIMKKIEFDEYSTKISTSVIFHMAFAQISHDYYLII
VRENEIYFEKISTKIVSEYRCRSIVVLFDETFLKQHLLKRIKYYFVPCEKYIGLNCFYDE
LHICLCTQNRQVNCFEFNHNMTYDCNGLNFCHKRGNCFLDNNKCPKSKFCSCTDCFFGST
CQFSTKESILSLDIILGYHVRLNVEFKQQKRIVKIATILTAIISVVGMINSFLCSQTFKR
KDMRNIGCSRYLYASSIISLLIMIFLILKITFFLTLQMNSSNKDHKFFHIQCLSMDYLLR
CLLFINDWLYAFVAMERAVNAAKGIHFNKIKSKQIAKWMILIIIVFISITCLYDPFQRRL
MYDEEGERVWCLSEYSPFIRIIDSIVNVAHFLVPFLINIISALTIIFFVTRTRSRAQTTK
AFKTHLNEQIQSHVHLIISPLILIVLTVPRLTISMLSGCMKSARYSWIYLISYFISFAPP
SLTSVIFILPSELYRRELKSEIRNLFK
Download sequence
Identical sequences GSADVT00002374001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]