SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00002457001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00002457001
Domain Number 1 Region: 1288-1594
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000156
Family Rhodopsin-like 0.023
Further Details:      
 
Domain Number 2 Region: 1012-1057
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000637
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 3 Region: 579-613
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000072
Family LDL receptor-like module 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00002457001
Sequence length 1599
Comment pep supercontig:AMS_PRJEB1171_v1:HG380764:633046:637845:-1 gene:GSADVG00002457001 transcript:GSADVT00002457001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSILFYTRRNMFHMKYFLYFIFLYSIKAVPQLNLHFTDQISVNQYDEIGLRYNCLRLAT
NIKLGSLTRDIASFCMSESSSKFPMKIDNDSLKRFSFGDLAKMNITSEELYLWSISIDTT
EQYQYYLESNDSSLTKQIVYNCTLPRFGSMCQYQLYYYHENYTTLYEIIHGYYRSYPKHL
NNLTCYTHLKCHRGYSSACLDWTEICDGKVDCLNGNYDEEHCWQLELNECELNEYQCTIG
QCIPNEFVQDTSGTYDCLDRSDEKARRNDRTGDFRIIEPVFGLEDARCETTFLTSSCIQQ
RSYQIVESMFSRKDDSVSDKCWFAFKCFFAFSNSEYPQITSHTIMKKCIPAIRNECPYAL
YVPNIPSFLGHVYTAYKIDNGSFTNNLLLYYLCSNKSFHHGSLKLVSHMLLNNTKCFVSL
LPTSLEGSNIPKSERRYTKVMNNIFHQIKNFNPIISFFSNQCNASNLYQCINSSKCIGFH
RLIDGESDCPYHDDEDISENNNPQLFDRLKDRYYYCYYKKKYIPKALVTDEKCDCGYNND
VFCEDEHEYENFTRRTISFQTMCDRFRDVYPIIIDEQNQTDETECEQWECDNVYTRCDGI
WNCWDGQDEMGCKILSSIFNCTSNTRICVTLNTSQLTCLPFDKINDGHVDCLGGTDEPKL
CILQQEYLGRFYCMNSHTRKCATYNDLCDNKIHCPYGDDEQFCRKNRSISIFSSICQLNY
LVLGTDVEKFFCEFLKIESRPTKKYFRINGFNQSWQNEVNENELINIITIGDSNPIPLLD
EPRCHRGLDLYVWSNQSSNSHTSTCLCPPGYYGNQCQYQNERLSLAIRFHTLTESWRIPF
AILILLIDNTNQRIIHSYEQFTYLPLRDCKIKFNLHLFYATRPKDMNRTYSIHIDVYEKL
SLKYRGSFLYPVNFLFLPVHRLAYFINIPPLSHSQQHICSDHQCQHGRCIKYFNKQEIFC
QCDQGWSGQYCHSQHHCICSVNSLCIGMLSDNRSICVCPTNQFGPRCYLHNRICEQNPCR
NNGSCIPHDDFMLSYGKEYICICPKGFSGSNCELFDNQLDIIFDKDMVLSYSVFVHFIRI
VPFDEFIPQIPKTSPQKSTTLQTISQATNSIRIFWSQPYHLVFIETLEKIYYLTIVQPNY
HPSTKITKRIDSSHRCPPISELTNRTFAQLHVLRRMKSYYSICQQYSPHLLCFHDDLHLC
ICYDFDKKRLANCFNFDHEMKFDCFGRSGCENDGQCFQDSPECPRRFICACRSCYYGSRC
QFSTSEFGLSLDAILAYHIIPNVNLFSQTTIVKISLFLTILFVIIGTINGILSLITFQNQ
SVREVGCGIYLFSSSWMTLLTTIVFGLKYFIFLSTQMSIISNQTFLKVQCMSLDFLLRIC
LNMDQWLNTCVAMERATTVIQGAQFNRNKSKILAKKVLIILLILIISTSIHDPIYRRLFE
EENENDDTKRIWCIVTYSSNLQIYNRIVNTFHFFVPFLINLISSIILITKKSHQRSNLHI
NRPFKDVLRKQFREHQHLLIAPVVLFILALPRLILSYLSKCMNSTKDAWLFLCGYFISFI
PSMIIFIIFILPSDFYTKEFRKSMKRYRNPFRQRISPIL
Download sequence
Identical sequences GSADVT00002457001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]