SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00003286001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00003286001
Domain Number 1 Region: 128-281
Classification Level Classification E-value
Superfamily Sec7 domain 3.4e-51
Family Sec7 domain 0.0000571
Further Details:      
 
Domain Number 2 Region: 325-447
Classification Level Classification E-value
Superfamily PH domain-like 4.82e-26
Family Pleckstrin-homology domain (PH domain) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00003286001
Sequence length 640
Comment pep supercontig:AMS_PRJEB1171_v1:HG380767:9838:15959:1 gene:GSADVG00003286001 transcript:GSADVT00003286001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNGYTQYTKSERSRSCENSLDTCGHKSPDELTISSSSLIDLPIPSVSHADYDNLSSVNG
NNHANEQLSSTSQQSTTKVSSQSSSPIFCELDQKTKDAIDARLKDIDDEFELNLPVTWET
VNKSVDLPSARRLAKRLYALDGFKSSDVVRHLCKRNDFNQLVAEEYVKLFDFQGDTLDRA
LRKFVKQFTIIGETQDRERVLHFFAARYLDCNPTTFTSVDACHMLTCAIMLLNTDLHDSK
ISTKMTFQQFSNNLQELNDGVDFSKDLLKSLYNAIKNEQLMDETALGSDDYNDVRLGGHG
TLHGYSNCINPFLEISDTSKSVEYMQGYMMRKCCVESDGKRTPFMRRSWKAYFACLRDMV
LYLQKNDQHPATILVGDTNAIRLHHAYACEAIDYRKRQHVFRLKTADWAEYLFQTSDREL
MRKWIDAINLISASFSSPPLPAAIDSSSIHFQRPLLPSVQTRYSVFEQYEHILKQINELS
RQLNDLKTRTYSTIHNENILTTNGDIKQQPVTMKARDMIENKTRKEYFEYELKRYETYAD
RLRRHFQQLQLDLSCLKPMNSNHSQDSSNHSGPIEALSGIHNIQQQSFPQHQLIPIRSTL
SSVAFKKTPQSPNLTITNPNRYSYMMAVNTHPVTMNEHQL
Download sequence
Identical sequences GSADVT00003286001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]