SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00003390001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00003390001
Domain Number 1 Region: 425-487
Classification Level Classification E-value
Superfamily R3H domain 0.00000000804
Family R3H domain 0.0066
Further Details:      
 
Domain Number 2 Region: 254-320
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000000827
Family Double-stranded RNA-binding domain (dsRBD) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00003390001
Sequence length 548
Comment pep supercontig:AMS_PRJEB1171_v1:HG380767:306628:308386:-1 gene:GSADVG00003390001 transcript:GSADVT00003390001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVQPICAEAAKNAIDPVLLSQQRAKLAKMQPFLFSLLNTLADASHAIDLISTQSNKYHL
NTDFECDDKPTLNGFHGHLIVEQIEIADGHGLNKKLAKKQVYSNALKSISSAKSFSLELR
HQIRWTLVCHEDSSGLLKIPPPRRPMALRGEERPSRWGPPTNLSAVTPSSTSAVRHFHER
RVEEGSQREREYHTTNGICIPPPALIEPPLTRVDIGKDLSKCTSSTDEAIANNIRRLIPN
TFVVFELLDFDENIPGHYVSMLFTSLSKNKLDLKYEFIHVPNGFMITYSINNRFFMSWIA
PTKVAAKQMGAKKAIEMLKTLYPSIKTKHVVTDMSMNENEIQGIKCRLIRRAQLYEQSSL
ATSMTTTNNTAPPKEDMGSKLLKKMGWIGGGIGKDLQGIAEPIQIEDLQGRKGLGSSSLF
PNQMFIKNLRQLLENFITNNNNDDELQFANEFNSEERKTIHKEAMKLHLTSNSYGRDGER
RIRITQKRNVDQLVDHLLTHGGETARYELKAQTQPRSITQTLSQRKYGQIAPPSSQWTAP
DACDDENL
Download sequence
Identical sequences GSADVT00003390001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]