SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00003399001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00003399001
Domain Number 1 Region: 2401-2663
Classification Level Classification E-value
Superfamily YWTD domain 7.32e-46
Family YWTD domain 0.0000149
Further Details:      
 
Domain Number 2 Region: 1446-1678
Classification Level Classification E-value
Superfamily YWTD domain 6.67e-41
Family YWTD domain 0.0000186
Further Details:      
 
Domain Number 3 Region: 3221-3481
Classification Level Classification E-value
Superfamily YWTD domain 8.37e-41
Family YWTD domain 0.0000448
Further Details:      
 
Domain Number 4 Region: 389-653
Classification Level Classification E-value
Superfamily YWTD domain 1.19e-33
Family YWTD domain 0.0000817
Further Details:      
 
Domain Number 5 Region: 4048-4303
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-28
Family YWTD domain 0.00015
Further Details:      
 
Domain Number 6 Region: 735-936
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-26
Family YWTD domain 0.00053
Further Details:      
 
Domain Number 7 Region: 2082-2322
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-24
Family YWTD domain 0.00043
Further Details:      
 
Domain Number 8 Region: 1788-1986
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000000107
Family YWTD domain 0.0011
Further Details:      
 
Domain Number 9 Region: 1394-1441
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000032
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 10 Region: 216-256
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000681
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 11 Region: 2875-2914
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000707
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 12 Region: 3565-3607
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 13 Region: 1105-1141
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 14 Region: 3172-3223
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000248
Family EGF-type module 0.01
Further Details:      
 
Domain Number 15 Region: 3090-3128
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 16 Region: 1026-1062
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000929
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 17 Region: 3608-3643
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000101
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 18 Region: 3052-3091
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 19 Region: 3142-3184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000202
Family EGF-type module 0.01
Further Details:      
 
Domain Number 20 Region: 2746-2789
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 21 Region: 21-60
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 22 Region: 3806-3847
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 23 Region: 1066-1103
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 24 Region: 96-133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000484
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 25 Region: 181-218
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000484
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 26 Region: 3856-3900
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 27 Region: 3012-3045
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000641
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 28 Region: 1268-1305
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000995
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 29 Region: 2922-2957
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000118
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 30 Region: 1227-1263
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 31 Region: 1186-1223
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 32 Region: 3897-3931
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 33 Region: 2713-2750
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000034
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 34 Region: 3763-3805
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000034
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 35 Region: 3727-3767
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000497
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 36 Region: 3642-3683
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000511
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 37 Region: 3682-3724
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000694
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 38 Region: 1145-1185
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 39 Region: 259-294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000055
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 40 Region: 2791-2834
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000055
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 41 Region: 141-177
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000576
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 42 Region: 3526-3563
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000589
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 43 Region: 58-97
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000707
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 44 Region: 2838-2877
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000956
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 45 Region: 1357-1407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000133
Family EGF-type module 0.01
Further Details:      
 
Domain Number 46 Region: 2959-3008
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000314
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 47 Region: 3945-3978
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000511
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 48 Region: 656-709
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000115
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 49 Region: 1312-1351
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000131
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 50 Region: 3979-4013
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000305
Family EGF-type module 0.012
Further Details:      
 
Domain Number 51 Region: 332-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000837
Family EGF-type module 0.027
Further Details:      
 
Domain Number 52 Region: 1706-1751,2036-2075,2656-2715
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000863
Family Growth factor receptor domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00003399001
Sequence length 4360
Comment pep supercontig:AMS_PRJEB1171_v1:HG380767:320569:339706:-1 gene:GSADVG00003399001 transcript:GSADVT00003399001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLKLLIFLFCSNFLLLYSTTDACGINEWRCETGGRCIPVAWRCNRINDCTDASDERNCT
YSRCMDTQFDCGDRCIPLSWRCDGDNDCANNTDEQNCPPRRCSSTQFQCNDSRCIEASMK
CNHVKDCTDGSDEGAFCNYRQCDPSTEFQCDMQRCIPLTQKCNGYYNCDDRTDEFNCNGT
VCSTNQFRCVADGRCIPGYQRCDFRLQCIDGSDEANCTRPNCTQAQFRCANGRCIPSSWV
CDRDDDCLDRSDEMHCGARQCPPHMYPCNITGQCIDITKVCNGQQDCIDGTDENAQCGSR
FCGLYSCEHACRPTPDGRGICYCPVGFQINPVNNRSCIDVNECEIWDECDQDCRNTVGSY
VCSCRANYTLETGNRCKHINSDNMKMFVAIANKIYEIDRLGNARIVYTGRENMTINAVDY
HYRNRILYFTDSRAHQIYSLSLSSSSSSSATLILEKNILTPVSIAVDWITNKLYIVEFEL
ARIDMFSLDGKQMKTNIITSGIHRPVAVAIDPIAEYLFFADEGDLHRVSAKIFRCLLDGS
QCTVLIDQKLDQPSDLTIDYIKQRIYWVDRSFDHVESCDYHGARRITITSGSQNIPFTVG
IDLFENNLYLTDDMKGAVLQLRRHFSSNTSNFYKPQSFIRPRGISVYHETKQPDRINPCN
GTYNGGCEHLCLLGRANLLANSYQCRCQSGFRLKSDLKTCEPVKDFLLLTRLFSIRGIDF
NRDSKIEARSPIVPDPRTVIMDSVFDYRQKLVYFYSERSQMIYVSYMDGEKPKPVTTSKI
FPLVSAMIYDWFSKLLYMTSSTERQILVVRMNTTDFPQRVLVNDTIGLYGITLDPSQGYV
FYSTIARPAKIYRMLSDGTNRNVIVPNELGTPYHLTCDYMTKRLYWTDGTLSRIQYSDYN
GRNIQSLRGRSISHPFGIAISGSRLYFTDMTLESVFESSKTYSGYASAIRSNIPAISTVR
VYAESSQPMNITHPCWTNNGECSDFCFPKREQGTLTRICGCRYGRKLNSMNNIQCVDNSE
AEPSQISCIGRFQCRNGRCIPLSYRCDGDDDCHDNTDEQNCPAGTPQCRTTQFQCRSTGV
CINKQLVCDGYAHCLDRSDESNCSQTCADNQFRCATGRCISKSWLCDNENDCGDSSDEQN
CHERTCDPLTQFTCPHTPGKCIPTAWRCDGQNDCGDNADEHDCPPISCGTGQFLCTRDQR
CINATRRCDGIADCPSMEDEQNCAGSTPTFCRADQFRCGTTCIPNAWRCDGHRDCADGSD
EPSTCGARNCTSTEFRCLSSGECIPETWVCDHEDDCEDGSDEHTEQCQAASFSCPDNQIP
CPDTTIHQCVNVSQVCDGKPDCPGGGDESPLCNTDQCSVNNGECSHICHASPFGVLCLCE
LGYHVTNSTNYKKCEDIDECVEDPFTCHQYCLNTNGSFVCGCGEGFILQPDGRSCKIINE
SGIRLLAAYGSSIGWFSPTLETFGQVTLGSNIRYVPAFDVDNRTDTYFWSDLASNTIYSR
SSRANNYTKIISSGNSYIASIAFDWIGRNLYWTDYILEHIEVASADGRHRRILLHENLTN
PWAIAVDPRPGVRFIFFTDWGKNPRIERCSMDGQQRMTIVNDSIQMPFGLTLDFIREKVY
FSDRHLNYIEVVSYTGENRRKILANTHFLHAPTSIAIFENYLYWFDSNSNEVRRLNRFEH
GIKAQKHTRILSRSGINHLKISHQIYQPSGTNPCQQSRCTQLCLLSHTASSGYTCACSTG
FYLERDQFTCTKDYSPFIIYMRSRTIGGINVRHDQRYVDENSNYDDLWERLVTVTDIDHG
YEFAFDEANETIYWTQTKGILPDGSLTYEIRRISFDGTNETVFYGDDEILVGMEIGTMQV
DAVGRNMFIVNFYHSRIDAISLNGQYHTVIYSSQENETGIMRPIALDLDTTNGYVYWIDL
GGGQVPMKIGRVRFDGKHSENVITENLLQPNYLVYNLDLHCIFWSDTGIQKISYHCMDSG
DTKVLDVEVSRPHEGVYKKWFDHNLNPITDIIPVRVNQRDPIQVRAYPRYEALNSYCYYG
SYCEQLCFQIDSINHNTPTCDCAIGYKLNSDGRSCSPKSQQYIIYSTHSLLRAFDHRSND
STREDVMPLIAGNNMEMLSVRYSTREIYWIHANRLIRRAIWTDNRTWNVTTHLQISVAAE
QNYVLGLALDWIAGNLYFSYVSNKYGHLEVNRLGTDHRLILRKGTNETIYALAVNPKRRY
LYWCDRGARAHITRSFLNGENVTYLVTTQIIRPESITIDYLTDDVYWSDIIRDTVEVISW
DGKNRRTVSRNIPKAISLLIANNDLYIMDRAFSSILRINKTASNMTQRLESVLSLKNYEV
GGMALFDEQPNYESPCQSSTVRQRFCEDLCFSMPGTSVPQCACAFGTLSVDQRTCQPPNE
YLLVAMEKEIRSMSMQPHRLATSAPWRSIKNLSMAVGVDFDYRDKKIFYTDIQVKDIFSF
DMDDPNPNARRLVQSNVTGRSQPVGIAYDWVSDRLYWTDETYGRIISARNNGSEKVIIAA
SSRPRAIAVHPCKGLLFWSDVGPSPSIRRSTLTGRQVTYLITTNIRWPNGLTIDFDDDRI
YWADAWFDRIERASLDGTNREVISSVVHPFAITVHGHYIYWTDWTLRGIYRAEKYTGANM
VEMQNNLPYRPMDIHVVSDQRQKCSFSPCNISNGGCSHICKTGLNNQVECTCPSGQQLKL
ANDRRMCVPLSSSCASVNFTCRNGQCISRRKVCDGQGDCSDNSDEDTRFCSAYTCRPTEY
RCLSGGCIPYIERCDRKIDCNDGSDENNPYQPCVYPQCPEGQFTCANFRCIDTFKRCNGF
DDCNDGNVTDEIGCPSRICNGTNSMKCPNNNICIQRSYLCDGDNDCGDNSDESPIFCQSI
QCNTTEFRCGNGRCIPYSWVCDSRRDCADGTDEPADCRSSNRTCPIELWKCDNGRCISPD
QRCNGIDDCRDGSDEDERHNCAEMSCRSTQFRCPTGLKNNPRIRCLDQSAVCNGIANCMR
AEDEANCTRRNCSSASQFQCDNGLCVPRSYVCDHDNDCGDGSDEPASCASQYRNCTSTEY
RCENGRCISKSLTCNGFNDCHDNSDEKPSLCQTEQCPGGQFQCRNKQCIPYEVVCNGVRN
CTDGSDEPASCGVNECASTILSGCEHGCINTLTSFRCTCRPGYKLATNKKNCWDINECVE
TPSVCQQLCENTQGSYICKCASGYEKGLDGRSCYRTNRTIIPHVLYTNKYYIRAIDLDEQ
TEMTIARGFLDLSSITYDWKDRKLYVGDNVANKIYRMNFNGTQSTTVIEGNQVRYLRALA
VDWIGRKLYQLSSMPELRVCELDGRNQITLLNSRYLSQPNYLAIDPLVGYLFYSDWGQPH
IGRINLDGSNFVKIIGTDTAGPLGLTIDIITKRIFWIDRRLQRLEFSNYNGGERKIAFSG
HDYVPYSLGLGFIDGYVVWSDFTNHSLIRADALNGSNKHVLLPDTINEVVAISIIHPSLQ
PQIPNPCGTNNGGCSHLCLLSANQSYTCACPEYFSFLNNGNNRTCVTNCSCNQHRCGSPN
ERCIPWSAKCNGVIDCEDGSDEPSTCPQRQCAANQFQCRNQNCTPISFVCDGMDDCRDNS
DEENCECRCMPGTFRCNSGACLPMRFRCDGARHCSDGSDELNCGNRTCSHHQFTCTNGNC
ITASYECDLDNDCGDNSDENAYFCRNRPCRPDQVRCPNSYKCISNLARCNGRNDCGDNSD
ENPNQCPLCNDASHFRCNDGGCIPRSWRCNHRNECRDGSDEDPETCIYRECSEDEFRCSN
GRCIPQRWVCDHDYDCGTGDTSDETTDCIARPCPDGRFKCASGHCVSNTSRCDGIPQCAD
VSDEAGCAPRYPNGTYCPADRFTCNNTLCINKNWACDGDNDCIDNSDETLEVCRTVPCNT
TNHFRCTNGRCIYRWRVCDHVDNCGDGSDEDIHGICRTRNQPLTCPQFRCPHTNRCIRFS
DLCDEFDDCGDESDELTYINECQNSTLNYCSQICINKKGGFHCECAAGFESSGVNRSDCH
AGDPTIDLLISEPEDIRRLRRNSADNAAHYGVLIEDQHNAGFISIDTTNRMFYWIDESNY
EVYRAHLTPSSISIAHPQELLFEDTDHTINPTSISIDWIGQNLYATDATHGCIWVMKNDG
RYATKLITNIESPWIVAVNPILGILYFINYEYEMYNNVTERVVAIESAYMNGENRTILVD
TDIIYPTDLVIDFYQNYRVYWTDEKKESVESMNYDGTDRITIAHIGIHAPHSLDIFGSHL
YWINRENRSLNSIEKFGRGVSTRVLDHLESPLFVRIYHPLKQIQSVSNPCLTSNCSHLCV
LKPSNQYQCLCPLDTDMQEDSRTCNARMYTVQFKKNLYLL
Download sequence
Identical sequences GSADVT00003399001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]