SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00003409001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00003409001
Domain Number 1 Region: 653-755
Classification Level Classification E-value
Superfamily R3H domain 0.00000000000353
Family R3H domain 0.009
Further Details:      
 
Domain Number 2 Region: 31-96
Classification Level Classification E-value
Superfamily RING/U-box 0.00000494
Family RING finger domain, C3HC4 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00003409001
Sequence length 764
Comment pep supercontig:AMS_PRJEB1171_v1:HG380767:365456:368169:1 gene:GSADVG00003409001 transcript:GSADVT00003409001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQQANIRPSNHHSLGRSTGEVENLRSTLTEQLLENVYECMICIIKINRDEEIWSCDICY
KMFHLNCIRKWANSEESGTDKNWRCPGCQYSYSTNPNYTCFCHKRTNPIFQPGEIPHSCG
ERCEKRLNTKSNDCNHRCSELCHPGPCPTCTTMVKRSCLCGRESQTIMCSSNSLIKCENK
CGKLKLCQHHRCELVCHPRDCEPCDQLIKQKCLSHGTEREVLCTIETGDTNLYTCGEVCG
KLLQCGQHRCTKTCHDGSCSDCLLLPKNCKTCACGKTTMNNEQRTSCLDHLPTCDKLCDK
ILSCGPTNDHHRCSAQCHNESCPPCNKKSILQCRCGQSSQSTSCVEAIQYDPIKNPFCCE
RRCNRKKICGKHRCTEMCCDRDIHVCEIICGKTLNCGIHKCEELCHKNPCRKCPINSYDE
LTCRCGQTVLQPPIECGTKPPTCNYKCDRTHTCDHPVYHSCHNDDECPPCTHLVSKMCVG
EHTLRNNVPCHLKEVLCGQPCGKPLQCGVHTCQRACHSGPCQTVDQKCTQRCAMKRRECG
HPCNVQCHGHEQCPSTTCREVVKVRCPCGRLVKDVVCNIKSNESSENKDDVNLTQSLVQA
LSVRTIDLSLARKQQQQVQLPQLECDDECRIIQRNKALAQALSINPEESRQSVVAYTDFL
RDYAKRNVEFVQTVERQFAQLVEETQRHRASKRCHSFKPMKINERHVVHELGTFYGLETQ
AMDPEPHRNVTAYASYGVCKIPTVLLSETIRREKLKVPPPVTLI
Download sequence
Identical sequences GSADVT00003409001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]