SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00004117001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00004117001
Domain Number 1 Region: 18-56
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 2 Region: 279-318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000243
Family EGF-type module 0.0028
Further Details:      
 
Domain Number 3 Region: 140-182
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000117
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 4 Region: 98-138
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 59-97
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00004117001
Sequence length 347
Comment pep supercontig:AMS_PRJEB1171_v1:HG380769:615214:617055:1 gene:GSADVG00004117001 transcript:GSADVT00004117001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVFRLDDNPSSSSSSSPLCPSNLFRCDTNRCLPYAFVCNGEYNCHDQTDEMNCSFTMMK
DEYHCKLTNRCIPKRWRCNGINDCLDSFASDELDCPMNRKCLSNEFPCRSIDQCVLSTAV
CDGIQDCIDGSDESSSICLFPRFCTRDQFSCKSTKLCIPKSNLCDTISQCHDRSDEMFCT
CPIEDYLTRKLFYRCGLTNKCLPKNVECHIKRQCHSAISHDDEDDDDDDDEMRCSFINQT
CSMNKPCLDKNQYCDIHRYQRCICKEGYRMNETTGLCEDINECRERVICDHYCMNTLGSY
HCSCQENYQLKSDKHTCTRRIDLISSGKTKKNLIEFIKFNSFFRICL
Download sequence
Identical sequences GSADVT00004117001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]