SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00005010001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00005010001
Domain Number 1 Region: 47-101,237-393
Classification Level Classification E-value
Superfamily Sialidases 0.00000000000000333
Family Sialidases (neuraminidases) 0.031
Further Details:      
 
Domain Number 2 Region: 569-789
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00000000173
Family YVTN repeat 0.065
Further Details:      
 
Domain Number 3 Region: 944-982
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00005010001
Sequence length 1002
Comment pep supercontig:AMS_PRJEB1171_v1:HG380772:663288:667052:1 gene:GSADVG00005010001 transcript:GSADVT00005010001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIIPINQPNTLVIFDDNSQEISILNSTHQQKLFISFKPKRIHVFSSTNHLWFAETSDQIA
LYFSSNFGIDWNKLDDTASSTILGWSYKTNSLVILQHTRNIKLLDMATYKTQTILNDVPI
AKLFSRYLLAKRLNSNDPISISHIDNLGDDGFQVLPKRLQSQGNFYCAIEDIYTQDLLLL
FTTVNKFEETNGTLSTTCNLIGYSKGNLFNLTNIECELNNNDSPPNTIECSSKQVSLYQI
RGLSRNVFLANIASELTTVISFDNGINWNKTHYECDKMIDCPTNASIVLNSLVSSNEAPG
IIVGKATNGLNNYVAISSDGGQVWRLSSKGQNNVSAISNPNALIITVPDNDQHSFQYSTD
YGRNWHEKTFLNETSFQILSLLADSNNIFYILTINTTNSFNLIQFNFNTLVPDQCARHQL
KEWSLQGNCINGTKSYYKRRISGSQCLNNATDIRIQSCACSLSDFQCLPGYRRSLDGICL
PKSHFIISQDCSCNENNNTLLTKRRGYAKSIDNQCQHGIENYLADTFVTRHSPSERSFFI
YGVNAETKQSIVEIHSNDFDQNDDDDEDLIRNPLWSIDQRYEITALAFDENSKLIYMAVQ
YDRTASIYRIDQNLYQSNRWKNELIFDPNNELYKNLDGKIEYLTIDSLTQNLYVLVRNQI
TFQQNIFILNIRTQKQRTIVKNQHIQPAILLLDPIKTNLYWISHNSPSIFHIANLQGQMK
KQIQLFPDNSTISYMSYDPITYEVIFVVNSTIYGLNTLDHRRLIPRIIYEHSSNIHNALF
VYPILYFTNEIHNKTETTMIDLHAIDILARSYAKNMTKLKSFDSLKLFVDMTPAVAKSTI
RTINPCASNLCSDICIPLENEGFRCLCSDNAQYHSCSCPINERFAAGTCQTVNNQCALGR
VLCQNRINCAESAVLCERDHTQYTESFKNMTRCTIEKADDGFDCYYHDKQTSNSRCIPFE
WLCDGVDDCPLGNDEEHCHKMTTNIESIEKIPNRCLTEKKCK
Download sequence
Identical sequences GSADVT00005010001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]