SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00005401001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00005401001
Domain Number 1 Region: 618-814
Classification Level Classification E-value
Superfamily Sec7 domain 2.09e-58
Family Sec7 domain 0.0000493
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00005401001
Sequence length 1631
Comment pep supercontig:AMS_PRJEB1171_v1:HG380774:108332:115010:-1 gene:GSADVG00005401001 transcript:GSADVT00005401001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPFEAPKNAIYIILGEIQAITSSKKNNTRWSNTHTYEESPEMNSFQKLKTILNSVSDL
QDIDSNTFLTPFLDIIRSEETSGPITCLALNAVNKFLSYGLIDIQGESAASAIDKVANAV
THTRFVGTNPNDDEVVLMRILQVLRSLLLSPVGSKMTNDSVCEILQSCFRICFETRLSEL
LRKTSEHVLIDMVQLLFARLPQFKDDGTSSTLTKRVKIITRITTTTSSSDTSSNRRRSQQ
RVNSISSIKKQQINESQTNGMKICLDNLRFFILINFSYYRTNIICIRNKFNLCKESSQTD
DNERPTAIETATHAIPPSAPIDPTIVNNEAESTNETILPIIVPSFDESSPRIILTNEPSI
TTSEEEQQSQEITDQTSTTQTTTNNIGLNLLTVALEVGADHIANYPLLLSIVKDSLCRNL
LSMLSCNRIQLFSASLRVTFLIFESLRTHLKYQFEFFLTRLMELIVSEQSKVTYEQKEIG
LETIVQLLRIPGLPAELYLNYDCDSYLPNLFEELTKMLSKNAFPVGGLTSTHILSLDALL
SVIDHIELECQFQNSFMLFFFNLATSQSLTRPVPSGYALALSLQNIDINRSITPRESRHG
PKVRQNRMIISSNLPLQDDLKKIKHDKKILKQGSELFNQNPSLGINFLQENQILTNPLQI
TEIVKFLKDNPMLDKKIIGEYLSNRKNVNILEQYVKTFNFEDLRVDEALRMYLSEFRLPG
EAPLISSLLEHFASHWRECNNFQLANNDAAFGLAYACIMLNMDQHNTNVRRQISPMTCED
FKRNLSTMNNKENFDDRMLTEIYNAIKFDEIVMPAEHTGLVRESYLWKLMLKRSSITGEK
FLHVPSGSYNYDIFTLVWGQTMAALSFVFEKSNYDLVIQKSIQGFSKCARIAAHYFMSDV
FDNLVISLCKFTTLLNSREWIENLPVQFGLNRKARLAATVVFNIAHVHGDILRDGWKNIL
ECIIHLYKAKLLPSVLVEVEDFLDPTGRTTLIKEQTTQITKSDTGIFSSLAFLLGGGGLS
DSTISSNKQTTSEEQEAIKVATACIEECHLEQLLQETKFLIIDSLNELLKALLYGCQIAP
DSQKLDQDAAVFCLELLVKVVLQNRDRVTLFWPTVRHQFYSILVNANEKSFFVERTCVGL
LRIAARLLRREELASEVLASLRMLLLMKPHVIHSLSSEIAFGLHELLRTNAANIHKSDDW
FTLFSLLEVVGAAAHPPPVLQTTQNLSIDKPVLTSRSSINAESDNECSDCATNSTVDKGY
TSDSEVYRRSDYIVVSHDDLETMRTQQSILNQYKIDLNEKLSQHDRRALIKSCETLSFLI
RDSAHVTEENFEYCIHCIRTFIEATVTQQVTQQNSKKSNTKTLKQIHYDDEDDQEAIKQE
YQSLALQLLDLMHTLHTRASQIYKQTTTGQTDQMTSSILWYKCWCPILQGIARLCCDQRR
PVRSSALGYLQRSVLLPELHVLTPTEWESVFNKVLFPLLLKLLETTNIIDQHHGIEETRV
RVSQLLCRIFLQHLSPLLTLPTFTALWLTILDFMDRYLKSDQTDMLRESVRESLKNMLLV
MNTTGLFDGDQPLSVITKDRIHSFLPGLWEEVFKMSAPPLTSTIRANIETSAKPVTTTEE
NVSVNEPVATS
Download sequence
Identical sequences GSADVT00005401001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]