SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00006150001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00006150001
Domain Number 1 Region: 16-107
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000000000249
Family Pentapeptide repeats 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00006150001
Sequence length 279
Comment pep supercontig:AMS_PRJEB1171_v1:HG380777:66983:67942:-1 gene:GSADVG00006150001 transcript:GSADVT00006150001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGISFVDSKFQSNRHQFGYVSLNYSDFQNTSIENTDFNNSYLVSSNFDGAYLRNVRFFS
GALLINSSFENTNFSQIKFAQTNLFGAKIDLTDSSNFQFDNIILPNGTWMINSEKLIRNG
DAEATEENFQWTTTDNDLPVLYHHNKTGLSTVNSTIGARSFECSSKTKCKMEQRVELNMF
QIFRNTGEVEYIFSAYFGTDRECSNNSIQIRITFRQTMITIGETNPYIKSLNHSIYWQKI
EHRFVMERMRDSSFNILIYFNDNSASCYLDNIELHLKQK
Download sequence
Identical sequences GSADVT00006150001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]