SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00006185001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00006185001
Domain Number 1 Region: 1270-1563
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000778
Family Rhodopsin-like 0.028
Further Details:      
 
Domain Number 2 Region: 992-1035
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000322
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 914-952
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000709
Family EGF-type module 0.015
Further Details:      
 
Domain Number 4 Region: 656-694
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000409
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00006185001
Sequence length 1572
Comment pep supercontig:AMS_PRJEB1171_v1:HG380777:173712:178430:-1 gene:GSADVG00006185001 transcript:GSADVT00006185001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPMKYLFYFNSIYSIIALLQTNLYFTNQVSENEYNDQIGIRYNCFRLASYINKANLIRA
ISSYCLSESALKFPIENDTSLQTFSFTKLEKMNITSEDLYIWSTPIDIIEQYQIYLETND
LSLAKQIFYNCTLPRFGPMCQYELYYFDENHASLYELIYSYYDEYFHIPINLTCYTHVKC
YRGYSSACLDWTEICDGKIDCLDGNYDEEHCWQLEFIECQTSQYVCDIGECIPSEFVRDD
ENIFDCVDRSDEKQSDLGQIPSDIHYEPAFGYDDIRCENQFLTSSCLIFRHYLIAESMFS
VKDESISDKCWLAFKCYFGFPHPEYPEIDNDIYRECIPTINETCPDILYIPNIPVFFGHI
YTAFKNNYTLFDGNYILPYLCSNKSFTFASFDLVSDMLINNTMCFDISQFASTSVDTKYH
WMDRYFAPINEIYRQIEEINSINNFSLHRCNESNLYQCLNSSKCISFHRVMNDVYDCPYY
DDENIFEDKNPQLFAQLQYNYYKCHTTNKYISLAAINNQECDCGYLEDDLCEDENELKIF
IQTTIPFQTICDRYRELYPITINGKNETDETECELWECNNIYTRCDNIWNCFYGEDEIGC
DSSPSMFNCSSDHRICVTRDTSEFSCLPTNKINDGQIDCLGGTDEPLLCRFHSPYLTGEG
GFYCRSNDTSECLGNYQLCNGQKDCPYGDDEQFCQKNRSITLNVEKFLRHISKHHRKMEI
KHFTIQGFHESFENEEKDEEILSVVNSKHYTRTSLFNNFRCHRGLDLRVWLNKSSTLYTS
TCLCPPTYYGNQCQYQNQRVSLAIRFHALAQSRQTRFAILTMLIDDTNQRIIHSYEQFTY
LSIRDCKMKFNLYLLYSTRPKHQNRTYSIHIDIYEKSSLTYRGSFLYPVKFFFLPVHRLA
FIVNIPSEDDSYRRETCSNKKCLHGKCINYFNTKETFCQCEQGWSGQHCDISYNCTCSLS
NSICIGLSSNNRSICMCQQNYFGPLCYLRNQICESSPCENKGSCIPHDDLMLGKKQRYFC
ICPKGYSGKRCEVIDTQIDLIFDSNIHLSHSIFIHFIKIVLHEQHGNTISKPSPARLTTL
QTISQETNSIRIYWSHPFHLTFIETLDKTYYLTVIQPIYNYSTIIIQRINSSHRCPSINQ
LVNQIFSQLHVLHRIKSYHLICQQYSPHLQCFHDDTQLCLCYDYQTKRLANCFYFNHAMK
FDCFGQNHCENDGQCFQDSSDCPKRSICMCPSCYYGNRCQFSTSEFGLSLDAILAYHIIP
NMNIFHQTSIVKISFSLTILFMIIGLINGFLSLITFKNKNVCEVGCGIYLLGSSITTILT
MIFFGLKYFLYLSTQISISSNRLHLKFQCYSLDFLLRICLNMDQWLNACVALERVVTIVQ
GTQFVKKKSKQLAKKVLIILLILIIFTSIHDPIHRQLFEEEDNENENKKRIWCIVNYSSK
MHIYNRTVNTLLFFIPFLINFISTIILIIKKTHLKNHRSSKTTLCKQIFNHRHLLTAPVI
LFILALPRLILSYSTKCMNSINDSWIFLGGYFISFIPPMITFLIFVLPSKFYRKVYKSTI
SSRSNIIYPFSQ
Download sequence
Identical sequences GSADVT00006185001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]