SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00007143001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00007143001
Domain Number 1 Region: 96-265
Classification Level Classification E-value
Superfamily Sec7 domain 1.44e-36
Family Sec7 domain 0.0001
Further Details:      
 
Domain Number 2 Region: 16-95
Classification Level Classification E-value
Superfamily F-box domain 3.4e-16
Family F-box domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00007143001
Sequence length 278
Comment pep supercontig:AMS_PRJEB1171_v1:HG380781:13094:14205:-1 gene:GSADVG00007143001 transcript:GSADVT00007143001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQIFDRQFAESTLTSHAENQIMKISDISQLPPELALQIFRNLNATDLCLAACVWQTLAN
DEILWLQLCKSNWGYSSVYKRAQNEGISFRKIYLQLDEGTLRFNAGQGLQYFIENRLLDD
DCEEICQFIHNTRKLRAIEKRKLLQTRRDILERLIELQSYENQFLPNALRQFFSKLDAPE
DRNEYLSLLIENFSKRFHDCNRGLGLSIETIYVLCFSLILLSIDLTSPHVKNKMSKREFI
RNTRRAIINGTLSDELAGHLYDNIYLIGHVARSRTAAH
Download sequence
Identical sequences GSADVT00007143001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]