SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00009777001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00009777001
Domain Number 1 Region: 1058-1370
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.34e-29
Family Complement components 0.0025
Further Details:      
 
Domain Number 2 Region: 1453-1583
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 3.53e-16
Family Alpha-macroglobulin receptor domain 0.0052
Further Details:      
 
Domain Number 3 Region: 734-769
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000916
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00009777001
Sequence length 1635
Comment pep supercontig:AMS_PRJEB1171_v1:HG380792:165972:171748:-1 gene:GSADVG00009777001 transcript:GSADVT00009777001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVIIWLQFHFFCLIPILFAHQSADFFPYYSKNETNNIDEKGDGLFIYDQLDEVTSTNHS
IHRRQISLNIMTSQLARIPIVPSYIILGPRTVRPAQLVALSVTILRDEWNPMMVKALISN
DDMDVAAAEDLFFVGVPRTLEMRVPNNVRPGTYRLTLEGKLLTGEQKFYNVSQLIFEQKA
VSILIQLDRPVYRHETVVQFRCIPIYPDLSGYYHTIDVYMIGPSGHILRKWENQQTTAGM
VSLEYPINDAPPEGIWSIRCRVMGYEATKTFELYEFYPRKFEVNVTVPYYLPVNSPGVGG
IVTANYSTGMGVLGFARVIVRARDMSIPYDPRANPLNDVEFDRSVPSFVTTIDDFNGVAG
FFIPIATILNLVPNLDGKEILITALVHDPWWNETNNGTTVVSFYKPGTRLRFLGGPSMVF
KPRMIFTTYVAAVNADGTKFPPGPNRFIRIYTETDGGPIQQPADYILDASGIISHQFLAP
PDPALLFIRLRAELYDNNILVPDSTDEQRAIRYLSPSNSYLQVTSSTETPHVGDFMLFRV
NITQYVDFVYYHITSAGKLIFTNILPMDGAKQKTFDVGVSREMAPSAHILVYYIRYDGEI
VADSMNFHVNTSSVTNRVNITINRRKDFTGNTIEVLAYASPQSFVAFAGLGLVQTRLFPP
GNHFNPVMIYDELYSFDHYATTSFQHTWNSEMNIPMNRVFFPSQSYGYDAGSTFNSSGMQ
VFTDVNVQAIQTACAQNGLMQCADGSCYPPPLRCNGILNCPDGSDEAKCNTTTTSAYDFT
PLYRRLWPYWERELQLDFMWHQQFAYPDGRVQFRTTVPNVIATWVITAIAVSRLTGFGVV
DVPFIYEGTRQFFIKVEIPPIVRLGEQVGARVDVFNFQSHRIEALIILHASDNYRFVNLD
QNGVVSSYAPRLTDGQHHVLVILYPNEVRRLYLPFVPIVAGEVEVMIEGITGVSRDFYRE
VIKVNYEGLRNYYHTPTVLLLNNLPRQLNEYDVNVTERYVVPLDNFLAYVPGSGTCEIFV
SGDVAGPYFLLGYDEWLNTDNLIQRTTSPADSGLFDFGMMIYNLRYMLQGHGGRAFDQEK
LMKVLTFANMEYLRFMAMYTGDNPTEPWRKGSFSQFGFTNESSVYLTSWALMTLRDAVYP
EWEEKALFIDPNLRADIVAFLLTVQQPNGSWAELTTAIDRNKFGIRYTNISGTYQQLNLS
LTAQALISLQLNVDVRGIPAKFLTGAINRGKMWLERHFRLITDAFDMAIVTYALHVTNSA
EQDSAFAMLNYFKKMNENGIYYSNLNLPGMTKTWKNINPRYGPKPVQTDLEAHAVSATAF
VVMTYTHKARVKDVEQSVLWMQSMRNYIGGWSGTYDSCIAQRAIVGYAVLRGFEITSYNI
RMNLTSATSVDQHYDPIVITDENLIETQVRDVERVWGVVYIDGFGNGYALIQMHVGVNVE
FDQLIRRPEYVPFSIDVQPMLAGRNFSTIDYNVCLGWRPQNIDVLKASRSGSVMIEVQIP
TGYRVEERDLKMMIRGLYTRNLREAENWPGQVNFGFDYIDFDPICFQFQAKRWIPVANIS
RYYEVRAYEWFEPGNMNRSVYSLRNLFALDICEVCGSYQCPYCPYYSHGTLSIQSTMIII
FMLCILLELYIIIIT
Download sequence
Identical sequences GSADVT00009777001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]