SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00011965001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00011965001
Domain Number 1 Region: 122-279
Classification Level Classification E-value
Superfamily Sec7 domain 2.62e-52
Family Sec7 domain 0.0000513
Further Details:      
 
Domain Number 2 Region: 323-446
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-26
Family Pleckstrin-homology domain (PH domain) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00011965001
Sequence length 613
Comment pep supercontig:AMS_PRJEB1171_v1:HG380802:393662:398886:-1 gene:GSADVG00011965001 transcript:GSADVT00011965001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MINGYNTSTKSRSCENNLDTCGRKVSDELASSSSSLIDLPTPNISSNTDYDNLAVLNGHD
EINGDSTGVIQQPITRVSIQPQSPISGGLDQKTKDEIDARLKDIDDEFEFNVPVIAETVN
KSVDLPSARRLAKRLYSLDGFKSTDVMRHLCKRNDFNQLVAEEYVKLFNFQGDTLDRALR
KFVKQFTIIGEAQDRERVLHFFAARYLDCNPTTFTSIDACHMLTCAIMLLNTDLHDAKIT
NKMTFQQFSDNLHELNDGKDFSKDLLKSLYNAIKNEQLMNETTLASDDYNDVRLGGHGTL
HGYSNIVNPFLEIPDTSKSVEYMQGYLMRKCCVESDGKRTPFLRRGWKAYYASLRDMVLY
LHKNDQQPTTILIGDTNAIRLHHAFAQEAVDYRKRQHVFRLKTSDWGEYLFQTSDRDLMN
QWIDTINLIAASFSSPPLPAAIDSVSLRFQRPLLPSVQTRYSIFEQYDFINHQINELTKQ
LNDLRIQSYANNTINGDIKQIKACDMIENKDKIDYLQYELQRYEAYADRLRRHFQQLQID
HTSLQNNHHEHQQHHSFIGPIEAFSGLNSSQQPTSVSYKKNTQSANITLANANRYSYMMA
VNTHPVTIKEHRL
Download sequence
Identical sequences GSADVT00011965001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]