SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00012095001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00012095001
Domain Number 1 Region: 1292-1597
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000238
Family Rhodopsin-like 0.024
Further Details:      
 
Domain Number 2 Region: 1015-1060
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000704
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 3 Region: 940-977
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000369
Family EGF-type module 0.029
Further Details:      
 
Domain Number 4 Region: 582-616
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000072
Family LDL receptor-like module 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00012095001
Sequence length 1602
Comment pep supercontig:AMS_PRJEB1171_v1:HG380803:194297:199105:-1 gene:GSADVG00012095001 transcript:GSADVT00012095001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSILFYTRRNMFHMKYFLYFIFLYSIKAVPQLNLHFTDQISVNQYDEIGLRYNCLRLAT
NIKLGSLTRDIASFCMSESSSKFSMKIDNDDDDSLKRFSFGDLAKMNITSEELYLWSISI
DTIEQYQYYLESNDSSLRKQFVYNCTLPRFGSMCQYQLYYYHENYTTLYEIIHGYYRNYP
KHLNNLTCYTHLKCHRGYSSACLDWTEICDGKVDCLNGNYDEEHCWQLELNECELNEYQC
SIGQCIPNEFVQDTSGTYDCLDRSDEKARRNDRTGDFRIIEPVFGLEDARCETTFLTSSC
IQQRSYQIVESMFSRKDDSVSDKCWFAFKCFFAFSNSEYPQITSHTIMKKCIPAIRNECP
HALYVPNIPSFLGHVYTAYKIDNGSFTNNLLLYYLCSNKSFHHGSLKLVSHTLLNNTKCF
LSLLPTSLEEFNIPNSERRYTKVMNNIFHQIKNFNPIISFLSNQCNASNLYQCINSSKCI
GFHRLIDGRSDCPYHDDEDISENNNPQLFDRLKDRYYYCYYKKKYIPKALVTDEKCDCGY
NNEVFCEDEHEYENFTRRTISFQTMCDRFRDVYPITIDEQNQTDETECEQWECDNVYTRC
DGIWNCWDGQDEMGCKILSSIFNCTSNTRICVTLNTSQLTCLPFDKINDGHVDCLGGTDE
PKLCILQQEYLGRFYCMNSHTRKCATYNDLCDNKIHCPYGDDEQFCHKNRSISIFSSICQ
LNYLVLGTDVEKFFCEFLKIESRPTKKYFRINGFNQSWQNEVNENEPINIITTGGSNPIP
LLDKPRCHRGLDLYVWSNQSSNSYTSTCLCPPGYYGNQCQYQNERLSLAIRFHTLTESWR
IPFAILILLIDNTNQRIIHSYEQFTYLPLRDCKIKFNLHLFYATRPKDMNRTYSIHIDVY
EKLSLKYRGSFLYPVNFLFLPVHRLAYFVNIPPLSHSQQHICSDHQCQHGRCVKYFNKQE
IFCQCDQGWSGQYCHIRHHCICSVNSLCIGMLSDNRSICVCPTNQFGPRCYLHNRICEQS
PCRNNGSCIPHDDFMLSYEKEYICICPKGFSGSNCELFDNQLDIIFDKDMVLSYSVFVHF
IRIVPFDEFIPQIPKTSPQKSTTLQTISQATNSIRIFWSQPFHLAFIETLEKIYYLTIVQ
PNYHPSTKITKRIDSSHRCPPISELTNRTFAQLHVLRRMKSYYSICQQYSPHLLCFHDDL
HLCICYDFDKKRLANCFNFDHEMKFDCFGRSGCENDGQCFQDSPECPRRFICACRSCYYG
SRCQFSTSEFGLSLDAILAYHIIPNVNFFFQTTIVKISLFFTILFVIIGTINGILSLITF
QNQSVREVGCGIYLFSSSWMTLLTTIVFGLKYFIFLSTQMSIISNQSFLKVQCMSLDFLL
RICLNMDQWLNTCVAMERATTVIQGAQFNRNKSKILAKKVLIILLILIISTSIHDPIYRR
LFEEENENDDTKRIWCIVTYSSNLQIYNRTVNTFHFFVPFLINLISSIILITKKSHQRSN
LHINRPFKDVLRKQFREHQHLLIAPVVLFILALPRLILSYLSKCMNSTKDAWLFLCGYFI
SFIPPMIIFLIFILPSDFYRKEFRKSMKRYRNLFRQRISPIL
Download sequence
Identical sequences GSADVT00012095001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]