SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00012364001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00012364001
Domain Number 1 Region: 201-232
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000111
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 2 Region: 73-187
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000196
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00012364001
Sequence length 317
Comment pep supercontig:AMS_PRJEB1171_v1:HG380804:405869:407164:-1 gene:GSADVG00012364001 transcript:GSADVT00012364001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFIQIQTISFNISLCLIFVIFINIYLIQVQASSLNDYTYRRIRLREAEEYIMTSRVSDGM
KNSNVCGDGYRIEGALLKSFRYTTSETYLPYEDCFMTFQARRSNNLIRVQILSMDMNDIY
GGVNCLDSLRFYKSPYMCDKDKLVSVECGQLNGSEKINFISPTGIVTAHFSTDGGNVNGH
GFKVVLTSFRYPNKSHPCDSTDEEFSCFNGDCISSLLLCDGVPHCLDGSDELLNQSCLIY
SSESINRINNESDKQHHLIHKYNQWRGILIITFFLIILVVFTIFMVYFLCHRYICSIKIS
TNPTKQMHSTIVNIRKL
Download sequence
Identical sequences GSADVT00012364001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]