SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00012625001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00012625001
Domain Number 1 Region: 1238-1534
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000101
Family Rhodopsin-like 0.03
Further Details:      
 
Domain Number 2 Region: 981-1022
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000317
Family EGF-type module 0.017
Further Details:      
 
Domain Number 3 Region: 216-248
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000288
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 4 Region: 555-594
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000157
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number 5 Region: 907-943
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000323
Family EGF-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00012625001
Sequence length 1546
Comment pep supercontig:AMS_PRJEB1171_v1:HG380806:51071:55711:-1 gene:GSADVG00012625001 transcript:GSADVT00012625001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKIFIILIIQSLYSITRSQFNLYNTEEHRTVGSLHTNCLRHYSHKDWNFAESVEYCIDS
MDSNDVMIEPFPNTINGNLTFDQLRQLNINTQDLISWSASIDLAERYQFYIEKQENSTIS
NEIFFNCTKPWFGSRCQYSFGLGSTYAFEDIVRKTFSKKFFSSPPYLVTNLTCYIYLKCD
RGNSMMCLDWREICDGRIDCIDGGADEKECFILEINECNEDEYRCHNGLCIPKDFFHDKY
PECLDKSDLKDGPSDYTKAGYVSIFGFEEHSCLSGYKQFQCGDGRCVADFDECLTKRHLL
LYDSISQQGNLSYDCWSMIICLTKIYNQINGILCQKILETSNIHHKSQNCDPIIQFPIVP
VLFGHVRFLYTMNNIFDIDHNLAFIPNYICYDSELCDFLQPTFHYGIYSCRESYGMVFNS
TRIFRTWSSIISVVEPFFRKCSIRYKSENTSQELYANMYCCRNSSKCISKHHLVDHISDC
YLNDDEEEYESSCLLNHAGRFKCDKENNTCYSSIVSRNICPPRYQLNFDEINIHHICDRD
VQMLSVLIHGQNHTDETECEHYPCNNMYTRCDGFWSCPDGEDEENCTTNRHICPLKSLAC
VSPMNYSLICLSAHRINDKRIDCLGSADELHYCRQNIKHGNYYHGFRCWNGSECLGFVDL
CNKRQDCKFNDDELFCGNYQESCEGCQYINCTNVTETLCHITILGGVTFSLKTVPKYPPS
PKQRRIEHISQPQSQNLHSVVKVITQEPYDRTWPWRCNKGIYVSVWPGTNSSNYRCLCPP
PYYGNLCQYQNQRVSLTAKVTLFDRKNVYALIFTLIGEDGDREEINSYHELILVSKRGCQ
PVQNIYLTYSTRPKNNSMNYSIHVDIYEKIHLEYLASWYFPVPFSFLPNNRMSIILAISN
NEPYRPKFCTLKCRNGECMKYINKNKMFCRCHRGWSGTQCDIPIHCNDCSTDSMCIGMIH
NRSICFCRIDRGGPRCLLPLSCPSQFCENNGSCFLVNDVLHAKGFVCNCTEEFTGTFCQI
VKSRLEVSLDNLRFSSSIILFYIFNYIGGILRFEQMEQIVIPQQMKMFQKTTIIRLINKF
QMIFINVDGNFYLIVLQQDEQENITTSVNPSQRCSFINELLNSSLVNLHQIRRMKYYPMI
CQIHLSLQCFFDDPYMCLCTIDRFANCLKLNSTPPICRHTIYCENGGRCLNDDSLCPEST
ICDCTDCYFGDRCQFYAKGIGLTLDDILRYEIQPNINLFNQPNFVKYCAILIIIMFLTGL
INSTLTVLTFRMENSREVGCGLYLLASSVTSFLTVFMLSLKFCFLLFTQINPTVNNSLVY
GGCRSLEFILKVCLYTDSWLNASIALERLMTVKIGVSFNKLLSKRIARWTILFLPFVIMV
SVIHEPIYRNLFEDKYEERRWCLFLYSRSLHTYHVLISLFHLLGPFSANLFSTIFIIIYT
ARQRRALQLNISYREHQWQQFMAHKHLIISSIILTILSTPRIIIAFLSGCVKASYNPQVY
AAGYFISFVPSISIFIVFVMPSDFYKEQFKKSVKNGVNFIIHRNIN
Download sequence
Identical sequences GSADVT00012625001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]