SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00012865001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00012865001
Domain Number 1 Region: 1232-1524
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000201
Family Rhodopsin-like 0.026
Further Details:      
 
Domain Number 2 Region: 223-261
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000435
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 968-1011
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000151
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00012865001
Sequence length 1531
Comment pep supercontig:AMS_PRJEB1171_v1:HG380807:183503:188098:-1 gene:GSADVG00012865001 transcript:GSADVT00012865001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKLILLLIYYEILNLNCQLILHDIDKTTNEYIWQYDCLYYYVIREEIGYQELSNRIKDI
IPYCFRPIDKSEEFIEDFIDINSQRLTFEELHLNNITTKDLLFWSCPLDLVEKYELFSNQ
IDLSLSNEIFYNCTKPWFGLYCQYSFEFTEQMSMDDIVYNQFHRKFSYIGLFDLPKSFPC
YVHLQCNRGGLSLCLDWREICDGHIDCIDEGLDELFCFDMEQHECQEDEYRCHNGLCIPQ
QFWENGIGHADCLDRSDEYADVYYPNICFQDPTFRCEEHSCRTNWYEFSCGDGQCVQSYD
QCHNGRHLLLIESLTIQKDLSDNCFIGMICLTKLIQQIHGHSCEFVMKTIRDFLRSCDQM
FQFPSFPIYSGHIRFLYENISLKTNETFLIIPDYICYDQELCDCLIPNFFYENLTCLFSS
HIDLTSSITGHIWIDIILVISSYFRSCSTSKIEKFTYENSSFLYQCENSSKFISKHRISD
ENLDCCFGDDEDNTNIYSCSINSQYRIQCSEENKCLSSLHTQDDCLLNKKKISFANICNG
LNEMIFTDSKTGQIYTDESDCHYWPCKNIYTICDGYWSCSNGEDEENCFPSKCSHGTYSC
ISPVNYTLICLTSEKINDGIRDCLGSMDEMEFCRRVYPSNLNPKRFRCQNTDVCLSLSEV
CNDISSCPLADDELFCQNQTNLKEIFHYFNEIEQKKFVHFSIHTSSNYPQQIAFNQTFPW
KFEQHIIREYHYSQKISSISPWSCNRGLTIRIKSTKNQYRCMCPPSYYGDFCQYQNERIS
LTIGMISSERYDVYIIILMLINDNNNSSLKDIHSYELIEYIPSQSCDMKYNIYLLFSTRP
KDLSKTYYVQIDIYEKHTMTYHASWYLSIPFLFLPVNRISTLLFLPSEPLSSISYCSIQC
QNGQCMKYINREDKLFCQCFPGWTGYQCNIPIVCHDCSIDSLCIGSMNNRSICICPLMKF
GRQCSLTSLCPENACENNGQCISSDLMSISTKEYSCICSEYYYGSRCQYRKAQLNIFLQN
LEIPSYLLAFFFTISNDSEPTLTIMIQKLTLFQRMVTFRISIPYHIVVVRSNKNYYLAVL
QSHLNLNLVTQINPLQQCFPIESLFNSTMMTMLHFQRMKFYHILCERNSLLSCFIDEYYL
CFCTQDHHANCFQFQFNENHLQCSSKHTCFNGGQCLQDHPTCPSTIICVCTDCFYGNQCQ
FYSKGLGLTLDEILTYEIKSNVNLIKQSFIIKLCALIITIILLAGICNSILSIIVFKNKT
SQEVGCGIYLFASSIISLCIVILFALKFWFLIYSYRDFVGQNFIRFTNCMIIEPLLKLFL
NVNNWLNACVASERAFAVFKGVSFRKKASKQMAEWIIICVIIINMILLIPQTLNLRLFYD
KREDRTWCVTLYSELLNNYNSFSLFFHFFSPFIINLFSALFIIIGTAHQRVISQNQHKFT
NHFMTKFNQHKHLLISPILLLILSLPRLVISFKLNCKKSSDYFWLYLSAYFISFLPSILI
FIVFVLPSPIYKKEFTQFLSRIQRRYALFNK
Download sequence
Identical sequences GSADVT00012865001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]