SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00014841001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00014841001
Domain Number 1 Region: 147-188
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000114
Family LDL receptor-like module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00014841001
Sequence length 296
Comment pep supercontig:AMS_PRJEB1171_v1:HG380817:201552:202577:-1 gene:GSADVG00014841001 transcript:GSADVT00014841001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIEIMRKILNFRMYYWWILVLIQNVYSSPPQVQFITKCGQTLNFSSSSLSILYTPTSSL
SCCNITLAQSLSDSSEQITINILNMSIKNPPLKTLNKQFDLITFSTYTTSNRTYLKSDIL
NLPITFSLCQFTKQSFEILITNISKGPCQSNQYRCLTTNNNQWCIDEIYHCDSYHSCPQG
MNEDGCTKSMSKSSSPKIERTIRGGIVTTIIVFGLLLIIASVSIALVFVYFRRKHQRHRQ
FTYSLESTSDDWEPTSTGYRLFDNWTNNRRHTENNLDNLNIDANEHMPIATNMTNR
Download sequence
Identical sequences GSADVT00014841001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]