SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00015372001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00015372001
Domain Number 1 Region: 1220-1508
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000687
Family Rhodopsin-like 0.016
Further Details:      
 
Domain Number 2 Region: 954-996
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000399
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 539-573
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000236
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number 4 Region: 196-234
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000262
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00015372001
Sequence length 1516
Comment pep supercontig:AMS_PRJEB1171_v1:HG380820:146304:150896:1 gene:GSADVG00015372001 transcript:GSADVT00015372001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQTNNNGLYYDCLYYKVVNHTIQAFGIKDDLKTWYQVIPYCIRPFSETEKVYNEGTKGE
VLAIFTFQELRRQQVTTSDLLSWSASIDLVELYDEYLDVPSNVSLRLQKFYNCSVPWFGT
FCQYTFNISLSLNIIVNKTFTDKRFTNKSAITCYLHLDCDRGPAPACLDWREICDRKVDC
LGNDADEMNCFELEINECKENEYRCHNGICIPEEFLGEGYFYSDCIDGTDENTLFAHRHT
KCSKTPGYWCEESTHRKNPQSFVCGDGEITDDSNLEGGLQCNNERNVIIKRSLFSYVEHS
QLSYNCWFLLLCSMASNLYLNGDFNYYNIPKCTTLYTCQTIFVIFPQRPIIHGHVSLVYL
TNKTIFSSYGEISIFPDYVCYDVKKCPFLPSNSILNINGTTCRSTQELNLLAFTDIINLF
QSCLIIIENEHEINHNRSTLFQCPGTTKYISTHRVFDGISDCYKGTDEQDVDACQWNHKH
RFKCSTEQKCISFILVQNDKKDCREGEDETTSISQQITFQNLCNGYVHLQPTMIDGFIET
DETHCDNWPCNNLYTRCDGAWNCPNGIDELNCLPSTCPPDTHECISPITTKVICLPYHQA
GNGIVDCLGSTDEREYCRLQKPQRHQMRYKCWNDTSCVYNIHVCMEGVCFIEEKIYCSPD
IEYVLNRLNEDEKLKFPVYKYFMLDHLKTNLSSSMVKKKDSIELISNSIVRLTADQENMA
LNKTFTIKQTETCNRGILIYVGISLKIHCLCPPSYFGDRCQYQSQRVSLTLQFSRKCTPT
CYGVFGIIISLIDQDNIIHAYEQLTYLSTYECEKKFFTYLLFQSRPKNITKKYIVRIDAY
SKINLTYYASWILPVQFLFLPVNRISAHLIIPSHPVNSFKHCPVFCDYGRCFAYINSPNE
YFCLCNSGWSGINCTISYKSDCSADAKCLGKINNQSMCLCPVEKYGSHCRLQSICQNRTC
KNGGQCISENERVSRNSFICLCPIGYSGPTCETIQTKVHISFIDIEIPSSLLVHFITVQT
EYDPIRTIINAKIPFDQNEAIVEISTLFHIIIAQISNEYYLTYVNTNNTPSSVSIVQMKM
EQRCLHVLKLFNNETVAKYSLLHRVKYYHLFCKNKSQLKCFYDKEAFMCLCNEEGHANCF
PFDFNIKYTCKTYGDCQNNARCFSDRPNCPFSTFCVCEDCFYGSKCQFTTKGFGLSLDAI
LGYQIQPHLSINHQPNIVKITIALTIIMLVIGLVNSILSTITFQRKTKNESGCRQYLLAT
SIVSLFSTFIFSIKFLMLILSQMSIITNIIILRISCVSIDFLLRLIPIIIDWLNASVAID
RALSLIMSTKYDKNQSRRAVKWAIISILLFTMGSILHDPINRQLIEDEEENRRWCLIQYS
SSLQIYNSAINIFHFLVPFIINLVTAIIIIFVAARSRAAAQQQQTYQQHLKEQFHRHNHL
IVSSMILVIFATPRLIISFMSGCMKSARNPALYLVGYFISFIPPSLTFLVFVVPSESYTN
EFYAATKRFRTLIGRQ
Download sequence
Identical sequences GSADVT00015372001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]