SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00015413001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00015413001
Domain Number 1 Region: 217-251
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000249
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 2 Region: 1245-1381
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000879
Family Rhodopsin-like 0.03
Further Details:      
 
Domain Number 3 Region: 549-586
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000017
Family LDL receptor-like module 0.0035
Further Details:      
 
Domain Number 4 Region: 979-1019
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000268
Family EGF-type module 0.037
Further Details:      
 
Domain Number 5 Region: 904-941
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000268
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00015413001
Sequence length 1398
Comment pep supercontig:AMS_PRJEB1171_v1:HG380820:361472:365668:-1 gene:GSADVG00015413001 transcript:GSADVT00015413001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRIYILLMIQFLCSITRTQFNLYHTDQNHNVGSFYTDCLRHYSYREWEFAEIVEYCIDS
MNNNNVVTEPFSNTTNGNFTFDQLRELNVSTQDLISWSASIDLAERYQFYIEQQGNSSTS
NELFFNCTIPWFGSRCQYSFSLGSTYNFETIVRKTFSKKFFNSPPYRVTNLTCYIHLHCD
RGSSMMCLDWREICDGRIDCIDGGADEEGCLALEMNECNEDEYRCHNGLCIPKDFFHDDY
PECHDKSDLQKIVAYTRNGYVSIFEYEEHSCFPGYKQFQCGDGRCVGDFDECLTKRHSFL
YDSISLQGNLSYKCWSIMICLTKINNHINGISCRKILESSNIYICLQSCDVDIIQFPIVP
VLFGHVRFLYVVNNISDIDHNLALAPDYICYDNELCDFLQPTFRYGIHSCRKSDDIILNS
SMTFRTWSSIISIIERYFRKCSIRHKNDTTSQFQHSVLYCCRNSSKCISKHRLNDHISDC
YLNDDEEEYESSCLPNNAQRFKCDKEKKCYSPIVSREICPIRYELNLDEINIHHICDRDV
QMLPVLIHGQNHSDETECEHWKCNNMYTRCDGFWSCPNGEDEANCTTKRQICPLKSFACV
SPWNYTMICLSAHRVNDGHIDCLGSADELHYCRQNIRYENKYYGFRCWNDSQCITSIDLC
DKRKDCMFNDDEIFCGDYQESCAKCKYVNCTDVTETLCPIGNLGGVEFSLATLPLYPSSS
GQRRIEHISQQSRNLHSIEKLITTEPYDRTWPWRCNNGIYVSLWPGNNSSNYRCLCPSPY
YGDHCQYQNQRVSLTAKITVFDKKGIYSLIVSLIGEAGDHEEVNSYHELISISNRGCKRV
QNAYLTYLSRPKNNSMNYSIHVDVYDKTNLKYLTSWYFPVPFTFLPNNRMPINLAISNDQ
PFRPKHCSLTCHNGECMKYINDVKIFCRCHTGWTGARCDISIRCSDCSSDSMCIGMIHNR
SICLCRVHRGGPRCLLPLSCPNQLCDNNASCVLIDDVPNDRGFLCNCTEGFMDLLCQIPK
PRLEISLHNIRISSSIVLIYILWHSNNFMRFEQLEQTVLPQQLKMFQKSILVYTMMDFRM
AFINIDENIYLIVVQQVDQYNVTTSVNPSQRCPLINEVLNSSLASLHQIRRMKYYYMICQ
THLSLQCFFDEPYMCLCTIDRDANCLKFNATSPICRHTIYCENGGRCLNDGTLCPVSTLC
KCSDCYFGDRCQFHAKGIGLTLDDILRYDIQPNVNVIDQSILVKCCALLTIIMFLIGLIN
SALAVLTFRMKKSREVGCGLYLLASSVTSLLTVSMLTVKFWFLLFTQINLIANNSIVYGG
CRSLEFILKVCLYTDNWLNACVALERLMTVKTGVSFNKLLSKRIAQWVIFCLPLVTMISI
IHEPIHRNLFEDKYEERV
Download sequence
Identical sequences GSADVT00015413001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]