SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00015435001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00015435001
Domain Number 1 Region: 1240-1524
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000011
Family Rhodopsin-like 0.03
Further Details:      
 
Domain Number 2 Region: 216-248
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000524
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 3 Region: 550-586
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000209
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number 4 Region: 979-1019
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000226
Family EGF-type module 0.088
Further Details:      
 
Domain Number 5 Region: 904-941
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000031
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00015435001
Sequence length 1541
Comment pep supercontig:AMS_PRJEB1171_v1:HG380820:431110:435735:1 gene:GSADVG00015435001 transcript:GSADVT00015435001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKIYILLIIHFLCPITRTQFNLYHTDQNYNVGSFYTDCLRHYSYRVWKFAEIVEYCVDS
MNNNNVVTDPFPNTTNGNFTFDQLRELNVSTQDLISWSASIDLAERYQFYIEQQGNSSTS
NEIFFNCTKPWFGSRCQYSFGLGSTYNFETIVRKTFSKKFFNSPPYRVTNLTCYTHLQCD
RGSSMMCLDWREICDGRIDCIDGGADEEGCLALEMNECNEDEYRCHNGLCIPKDFFHDDY
PECHDKSDLHKVADYARTGYISIFEYEEHSCFPGYKQFQCGDGRCVGDFDECLTKRHSFL
YDSISRQGNLSYKCWSIMICLTKINNHINGISCQKILEPSNISICLQSCDVDIIQFPIVP
VLFGHVRFLYAVNNISDIDHNLALAPDYICYDNELCDFLQPTFRYGIYSCRKSDDIILNS
TMTFRTWSSIITIIDRYFRKCSIRYKNYTTSQFQHSVLYCCRNSSKCISKHRLNDHISDC
YLNDDEEEYESSCLPNNTQRFKCDDEKKCYSPIVSREICPIRYQLNLDEINIHHICDRDV
QMLPVLIHGQNHTDETECEHWKCNNMYTRCDGFWSCPNGEDEANCTTKRQICPLKSLACV
SPWNYTMICLSAHRVNDGNPDCLGSADELHYCRRNIRYENKYYGFRCWNDTQCITSIDLC
DKRKDCMFNDDEIFCGDYQESCAKCKYINCTDVTETLCPIGNLGGVEFSLATLPVYPSSS
GQRRIEYISQQSQNLHSIEKLITTEPYDRTWPWRCNNGIYVSLWPGNNSSNYRCLCPSPY
YGDHCQYQNQRVSLTAKITVFDSKGIYSLIVSLIGEDGDHEEVHSYHELISISNRGCKRV
QNAYLTYLSRPKNNSMNYSIHVDVYDKTNLKYLTSWYFPVPFTFLPNNRMPINLAISNDQ
PFRPKHCSLTCHNGECMKYINDVKIFCRCHTGWTGARCDIPIRCSDCSSDSMCIGMIHNR
SICLCRVHRGGPRCLLPLSCPNQLCDNNASCVLVDDVLNDNGFTCNCTEEFIGIVCQTPK
PRLEISLHNIRISSSIVLIYIFTYADSILRFEQLEQTVLPQQLKMFQKSILIYTMMHFRM
AFINIDENIYLIVVQQVDRYNVTTSVNPSQRCPLINEVLNSSLASLHQIRRMKYYYMICQ
THLSLQCFFDEPYMCLCTIDRDANCLKFNATSPVCRHNTYCENDGRCLSDGTLCPVSTLC
KCSDCHFGDRCQFHAKGIGLTLDDILRYDIQPNVNLFDQSILVKCCALLTIIMFLIGLIN
SALAVLTFRMKKSREVGCGLYLLASSVTSLLTVSMLTVKFWFLLFTQINLTANNSIVYGG
CRSLEFILKVCLYMDNWLNACVALERLMTVKTGVSFNKLVSKRIAQWIIFCLPFVIMISI
IHEPIHRNLFEDKYEEQVWCLFLYSRSLHTYNVFISLFHLLGPFCANLCSAVFIIIYTAR
QRAVLQSRISYRQHQWQQLMEHKHLIISSVILTVLSTPRIIIAFLSGCVKMSHNSQLYAA
GYFISFMPSVSIFIVFVMPSDFYKEQFTKSVKIGLNLIVQR
Download sequence
Identical sequences GSADVT00015435001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]