SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00016576001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00016576001
Domain Number 1 Region: 1303-1598
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000192
Family Rhodopsin-like 0.021
Further Details:      
 
Domain Number 2 Region: 1034-1079
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000629
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 955-995
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000489
Family EGF-type module 0.03
Further Details:      
 
Domain Number 4 Region: 217-254
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000632
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00016576001
Sequence length 1604
Comment pep supercontig:AMS_PRJEB1171_v1:HG380827:75147:79961:1 gene:GSADVG00016576001 transcript:GSADVT00016576001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFEKLLVFCLLIRLVKLEIQINFHLTDWTNENHDFQHDCLNVAAHIIKDSDPRQIISYC
MGEWPSNFNLTENNFESKFNFSQLAEQHVTIEQLYHWSASIDLIENYQIYLDQLLSADEI
SVSLATEVFYNCTLPYFGWRCQYALINYTANYSSLNEFVYDYYQNNRYEPTELTCYLHLD
CKRGPLPACLDWTEICDGIVHCLNDGLDEKFCWQLEIHQCNENEFQCGYGQCIPKSFTRD
PASAPDCLDRMDEHMSASFLLDNTDDQLYTREPIFAREDVSCTTSGKIFSKYRQTLTSSC
GPNREYLLGKALFSIKPKDLDDECWSLMKCIMQMPYSLEPTLTNILVPSLEICEYLSNKN
LFNQIVKTKCPEMIPISDDPFLHGQVYIVYNKAKLKYSSRPLPPTYICYDDQYFPIPNDG
KAFLLPTINKTCRFYTDVVNSEVSFWETRWLQLYIKPLKEWLRTKIALISNDSTFCNQSM
IYQCRDSLKCISKNRLLNTIMDCYYGDDEDYLTISNNTDLMKQLSHYTKCKGTNEYIHIA
QVNDGWSCDCKVPGDNYCSDEESGENYFKNTILFQTICDKYLHLSQEFVVDKNETDETNC
EHWPSLHIYNRCDGFWHFPNGIDEINCDPSIALLNCSENHHVCVSIETKNLICLPIEKAN
DGIIDCIGAADEPTFCDRTTINESNPYTFYCKYSDRKICILSHRICNDKIDCGIDEEDEF
VCQSNDLTGKPVTQGICAREFELYGSDIAKSLCRSFIQIGKRSHIYFTLDQSQNSLGPSI
EHGFLSLSIDSSETSEIIEPYQPHCHRGFPLQLRLNKELNLTSIICLCPPSFYGDRCQYQ
NQRISLTVQFHATAYSRQIPFIIIISLIDDSDERLIHSSEQLNYLFLKDCQKKFNFYLLY
STRPKNLQNNYSLHIDIYERRTLTYRASFIKHLNHSFLPVHRLVFQFNIPNSPDEIDNCV
TNQCIHGKCIRYFDDSNNESFCQCDSGWTGQYCTIEYSCSCSTKSLCLDQLANNRSLCVC
PMNKMGPRCLIDNNRCQEEICMNGGTCIPTYEYETSKNKSTCYCPKGFSGHHCEISRTKF
IISFDQTPDLHSLIFAHFIQIQTNNFPIRTTTVKRITMVQNFITIYWSLEFHLLFIELPN
KNYHLIYMEKTYQPQMVIEKKLTSRSECLNISEVFNQTILDYHRLHRIKYYHLPCQMNLF
LTCFYDEQQFCMCQQVMNEQRVSNCFEFDHNTRTTCLGKSDCSNGGDCYQENSPCPKYFL
CQCPVCYYGTKCELTTNAFSLSLDAILAFHIHSNRNIIKQSYIVLISEIVSILIIISGLI
NGILSLLTFKSGKLREFGCGIYLLFTSVIILLTMIIFTLKFWIFIYSQIGLIQNELFLKF
QCIFLDFLLRICLTMDQWLTAFVSIERAIIAVKGINFNQRKIKSFAKYIIGFLLFIIMLT
YIHDPLHRNLYNDDDDDEKRFQCIAKYRSSIRLLDYVVNTFHFIAPFIINIISTSIIIIS
KTQQRKSIQKKQKYGIILKEQIQQHKNLLIGPFVLILLVIPRLIIAFASSCIRSASDSQL
FLTGYFISLIPSTLTFVLFVLPSTVYKQEFHKAISRYRNLFKIY
Download sequence
Identical sequences GSADVT00016576001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]