SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00016850001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00016850001
Domain Number 1 Region: 482-576
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000417
Family I set domains 0.033
Further Details:      
 
Domain Number 2 Region: 343-378
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 3 Region: 438-485
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 598-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 5 Region: 389-431
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000707
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 244-313
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000152
Family I set domains 0.021
Further Details:      
 
Domain Number 7 Region: 114-199
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000166
Family V set domains (antibody variable domain-like) 0.054
Further Details:      
 
Domain Number 8 Region: 1038-1101
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000109
Family I set domains 0.047
Further Details:      
 
Domain Number 9 Region: 904-987
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000228
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00016850001
Sequence length 1120
Comment pep supercontig:AMS_PRJEB1171_v1:HG380828:464865:470068:-1 gene:GSADVG00016850001 transcript:GSADVT00016850001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAGYDDNDEENPSEQSTVVPGDGADKEDDAIPDEIESITTTTMPPKADRTTPSSSSDDV
DYYDEEDDDEESNTDSGSSSGSNTQRNVTRGNDTEEATVPSNVQPGASGRVELRVVVSPD
VIQVQRGRTVELTCTVYGGDQNTNIYWIQDEPERRHALIDSAGENDKQVTASQVILRSRI
TLDDPSKIGKYTCMAQDASQNTGSASVTMQEGAGYYPQPPYPGGVVPGPAPSSGGRGYLR
IIAPVMTEGDYVEITCEGAAPEDESSIQWYFNNKLLESSVVGDEQPLFPRGKTLHIRPIS
RPYLGNYRCTVPGAGYTDANSVLTFAGAGGSSDPIPVGPVQPSGRCSIDEATCRNGRCIP
RAYLCDGKNDCGDNSDETCSQPSGSGTDVCQPNEIRCSDTSRGRKCVQKFWMCDGDRDCD
DGSDEQQHWCELLPRQRFCKPSEFQCASANGTYGNPVCVPRSFQCDGYNDCPDRSDEIGC
TKPTIISPPQRQVEINAGETLTIQCTARGSPAPYINWRLNWGQICGDGSDNGRCTMAQSL
DANDPSVVTGTLTVRNVNGNDGGAYSCEALNNQGFIFAIPDAIVNVIIAGPVPQPPSCSC
NGHSTSCSSDGRCLNCQHNTAGYNCEHCAPGYQGDARRGTPQDCQYVAPLPLGNCDPSGT
HMERGGRCICKYNVEGDRCDRCKHNHFYLNPTTSNGCLPCFCSGVSSECRSSDWRRQAVS
LSLENDWNAVPKNFATERYEAGSKIQRRQNGRELALDQNSLGRPANEVLYWKAPKEALGD
VVTLYDGNIDIHFTNDGNDQEAPSNDEFIWLRGNNIDLVHKLPPTQRFKANTNATYSVPC
NERTFTRKDGTHIDRENILMALSDLDTFLVKINPIGGRRNAVLRGVTLNVAARDGYADSA
PTVESCSCPANYTGTSCEKCAQGYGRPHPLVGIYLGQCWSCRSLCHERSDQCDRETGKCS
NCQGNSEGDRCERCHAGYVLDPRSNQCIREDQYVPYPGSEGTGSRGSYFIGQRPYGGEGS
TPLRIVLDSNQPEQRIPLQILNIQPQSVVWGRTDGRPLPSGVFQENNDLVIRNPSNEQSG
NYVCTITHPDGTIERIPVYLDYPGQGYPGDKPQPVTGKFQ
Download sequence
Identical sequences GSADVT00016850001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]