SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00017569001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00017569001
Domain Number 1 Region: 68-164
Classification Level Classification E-value
Superfamily R3H domain 0.00000000000000157
Family R3H domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00017569001
Sequence length 171
Comment pep supercontig:AMS_PRJEB1171_v1:HG380833:33380:34071:1 gene:GSADVG00017569001 transcript:GSADVT00017569001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATDKKKKKKKNATSSHNTTSNSCSSDDTLETFVLIENRLTTDDKESETFTHRQEEANAC
YRRIDPNIRYTLKNMLKRHHLPFERISWFEDDVIPFFKENPDSVYLRDLNNGFDRMLLHA
VCQYLNLISKSFTRDGERYTQVENRRVEFIPPIILLSEYMKTMDGTMKKDL
Download sequence
Identical sequences GSADVT00017569001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]