SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00018115001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00018115001
Domain Number 1 Region: 34-490
Classification Level Classification E-value
Superfamily Sema domain 9.81e-87
Family Sema domain 0.00000859
Further Details:      
 
Domain Number 2 Region: 546-609
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000039
Family I set domains 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00018115001
Sequence length 685
Comment pep supercontig:AMS_PRJEB1171_v1:HG380836:82736:85924:1 gene:GSADVG00018115001 transcript:GSADVT00018115001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLVVLLFGIIFLDSISSSTIPHSKYVPNSIHKYTSGLNYYWNLLLDDDSLYVGGQNLI
VRLNRVNIEDRTSSIYKSIDIPSKRDEVQKCLSHSLNQAFDCENHVRVLLRRKSKYNDIF
VCSTNAFSPKIYYFNPDLTEKQGSKEGFGYCSRDPRHNNTALWSDEGNPQNYGFFYTGAV
IDYTKTEPIIYRPPSDDGTIKFLRTPQYDTDWLSAPEFIASFEIGSNIYFFFREKAEEQR
DIFPKMYSRVGRLCKNDVDTATIMANTWTTFRKARISCLSGTNESPFVFNDISAVAKVED
DRFIVSFISTPGDLTTSIICEYSRRDIDAALDGNFKEADSTSFWRELPRDHVPEGVSKNC
ESNGTLSDTALSFLRSHVLMNGNIFSSPPMEIAFQMSDTIITRLVTDSINSNTDHQMTVV
YAGTQDGQIFKLVQKKTGEKFTLLTSWILEENISEKSPVRNMVLAQDTKQLYVSTDAAVY
QFPINQCSRYMLCMECERDPLCHYDVQQNRCLNVDENNVKLAIARLQPESWCKKSVQRPS
KILQLTKKKGETVWLQCDVSEHLRTSIEWRWNGRNIQDTLFNNYLLTKEHNLIIINMNNS
LNGQYTCFVGHQPIVSYSLETDRDAFVYGDVSTTITNLSRRNGECNCLTAEKYIEKYNDW
CKEFENYQRAYNEWEVLRDQSCPKP
Download sequence
Identical sequences GSADVT00018115001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]