SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00018378001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00018378001
Domain Number 1 Region: 1282-1574
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000366
Family Rhodopsin-like 0.017
Further Details:      
 
Domain Number 2 Region: 656-692
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000498
Family LDL receptor-like module 0.0034
Further Details:      
 
Domain Number 3 Region: 1001-1045
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000503
Family EGF-type module 0.018
Further Details:      
 
Domain Number 4 Region: 923-962
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000586
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00018378001
Sequence length 1584
Comment pep supercontig:AMS_PRJEB1171_v1:HG380837:353610:358364:-1 gene:GSADVG00018378001 transcript:GSADVT00018378001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYIKYIFFIHCTMAIPQINLYFTTNEVTEHEYNDAIGIRYNCFRLSSNMDQASLTREIT
SYCLSEPSTKFPITNDISLQIYSFSNLAKQNVTSEELYRWSTSIDIIEQYQIYLESNDPL
LAREIFYNCTLPRFGPMCQYELYYYYENYSTLYEMIHAYYEMYPYNPTNLTCYVHLKCNR
GYSPACLDWTEICDGKLDCLDGEYDEEHCWQLEFNECQQNEYKCTIGQCIPKEFVQDDLK
NFDCIDRSDENSRFLHSYERSDKNEPAFAFEDVTCESTFLTSSCIQIRHYLLSQSMFSIK
DNSVSDKCWSALKCYFALSYKNDSEITNDIIDNDCIPTMKETCPDMLYVPTIPTFFNHIY
TVYKKNDLPYINNYILPYLCSNKSFFSVGSLDLVLDLSMKNTTCFKISHSSNIMMSNIPD
WSSRYQMSMESIFQQIKQLELITNFPHNRCNESNVYQCKNSLKCISFHRLMNGISDCPYN
DDENIFEETNLELFEKLKFQYYRCYFTGKYIPQSAILNTKCDCGRLENFFCEDENEIENF
TKRTVSFQTICDGFQELYPLMIDDKNETDETKCEQWECDNIYTHCDGIWNCLYGEDEMNC
NSSPVLLNCSSDQRLCVTRNTSELTCLSINKINDGIVDCLGGTDEQNLCPPTVIYRERRF
YCMNKHPLRCLKFLQLCNGYEDCLYGDDEQFCQKNRTMSMYNSICKPEYISLASDVEKFL
CNASTSENYKATVKYFTINRFHESFHNEINDNQQLNVITLDDYKPIPLLDNPRCHRGLDV
RIWLNKSSNIYTSGCLCPPSYYGKQCQYQNQRLSLSIRFHASVQSRKILFLILILLLDNT
NQQIIHSYEQFTYLSIRDCKMKFNIYLLYSTRPKYMNRTYSIHMNIYEQHSLQYRGSFFY
ALNFLFLPVHRLAFIVNIPFENNYQICSNRKCYHGKCIKYFNTKETFCLCEQGWSGQHCH
IPFNCTCSSNSLCIGTLNNHRSICICRENYFGSQCYIRNRICDRNSCENNGLCIAHDDFM
LSTNQNYFCICPKGFSEKQCQRNDTQINLVFDKNLFLSHSVFIHFITIIPLNPFAFRMTK
SSPQRLTTLQTISQATNTLRIYWSQPFHLVFIETLDKTFYLTITQSIYNYSRMITKTIDL
THRCPSINELVSKTFAQLHLLHRIKSYHLICQQYSPNLSCFHDDIHLCLCYDHQNKRLAN
CFQFDHHMKFDCFGRNECENDGQCFQDSPDCPKRSICICRSCYYGNRCQFTTSEFGLSLD
AILAYHIIPDANISHQTSIVKLSFSLTILFIILGLINGILSFLTFTSKRILKVGCGIYLL
SSSIITILIMILFGLKYFIYLSTQISMSLNEVFFKIQCYSLDFLLRICLNMDQWLTACVA
MERAITVIQGVNFVKDKSKRLAKKIIIILLIVIILTALHDPIHRRLFQEEDNENENMRRI
WCIVSYSTNLQIYNRIINTFHFLIPFFINLISSIILITKKSHRQLRFQRHRSYKVMLRER
VIDHRHLLAAPIILFILALPRLSLSYVSKCMNSSKDAWIFLFGYFISFIPSMITFLIFVL
PSQFYRKEYRRCFIDRSNTIHPAH
Download sequence
Identical sequences GSADVT00018378001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]