SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00020108001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00020108001
Domain Number 1 Region: 479-573
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000472
Family I set domains 0.031
Further Details:      
 
Domain Number 2 Region: 340-375
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 3 Region: 435-482
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 1117-1205
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000594
Family I set domains 0.025
Further Details:      
 
Domain Number 5 Region: 595-642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000711
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 6 Region: 386-428
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000864
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 241-310
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000188
Family I set domains 0.021
Further Details:      
 
Domain Number 8 Region: 111-196
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000021
Family V set domains (antibody variable domain-like) 0.042
Further Details:      
 
Domain Number 9 Region: 1035-1098
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000135
Family I set domains 0.047
Further Details:      
 
Domain Number 10 Region: 902-989
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000196
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 11 Region: 1214-1296
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000943
Family I set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00020108001
Sequence length 1317
Comment pep supercontig:AMS_PRJEB1171_v1:HG380848:303779:310193:1 gene:GSADVG00020108001 transcript:GSADVT00020108001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAGYDDNDEENPSEQSTVVPGDGADKEDDAIPDEIESITTTTMPPKADRTTPSSSSDDV
DYYDEEDDEESNTDSGSSSGSNTQRNVTRGNDTEEATVPSNVQPGGRVELRVVVSPDVIQ
VQRGRTVELTCTVYGGDQNTNIYWIQDEPERRHALIDSAGENDKQVTASQVILRSRITLD
DPSKIGKYTCMAQDASQNTGSASVTMQEGSGYYPQPTYPGGVVPGPAPSSGGRGYLRIIA
PVMTEGDYVEITCEGAAPEDESSIQWYFNNKLLESSVVGDEQPLFPRGKTLHIRPISRPY
LGNYRCTVPGAGYTDANSVLTFAGAGGSSDPIPVGPVQPSGRCSIDEATCRNGRCIPRAY
LCDGKNDCGDNSDETCSQPSGSGTDICQPNEIRCSDTSRGRKCVQKFWMCDGDRDCDDGS
DEQQHWCELLPRQRFCKPSEFQCASANGTYGNPVCVPRSFQCDGYNDCPDRSDEIGCTKP
TIISPPQRQVEINAGETLTIQCTARGSPAPYINWRLNWGQICGDGSDNGRCTMAQALDAN
DPSVVTGTLTVRNVNGNDGGAYSCEALNNQGFIFAIPDAIVNVIIAGPVPQPPSCSCNGH
STSCSSDGRCLNCQHNTAGYNCEHCAPGYQGDARRGTPQDCQYVAPLPLGNCDPSGTHME
RGGRCICKYNVEGDRCDRCKHNHFYLNPTTPNGCLPCFCSGVSSECRSSDWRRQAVSLSL
ENDWNAVPKNFATERYEAGSKIQRRQNGRELALDQNSLGRPANEVLYWKAPKEILGDVVT
LYDGNIDIHFTNDGNDQEAPSNDEFIWLRGNNIDLVHKLPSTQRFKANTNATYSVPCNER
TFTRKDGTHIDRENILMALSDLDTFLVKINPIGGRRNAVLRGVTLNVAARDGYADSAPTV
ESCSCPANYTGTSCEKCAQGYGRPHPLVGIYLGQCWSCRSLCHERSDQCDRETGKCSNCQ
GNSEGDRCERCHAGYVLDPRSNQCTREDQYVPYPGSEGTGSRGSYFIGERPYGGEGSTPL
RIVLDSNQPEQRIPLQILNIQPQSVVWGRTDGRPLPSGVFQENNDLVIRNPSNEQSGNYV
CTITHPDGTIERIPVYLDYPGQGYPGDKPQPVTGGLPHISIQPRVINLKEGQRMIVQYTV
GSHEPIEVTWEKLTDQGYQPIPSLFTVEPNRLVLQRATPDAAGTYRVVVRNSHGEDKQEL
RINVEPRRGRNRGPQVRFPQSQYEIGYGEVVDIAPNIAGASGATIVWSKDGSTNLPQGVT
ARDDGFLRIEGHSQDVAGQYSLDVTNARGRISTPLVVRWKDASSQQGQQGQQGQHGK
Download sequence
Identical sequences GSADVT00020108001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]