SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00021431001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00021431001
Domain Number 1 Region: 38-445
Classification Level Classification E-value
Superfamily Sema domain 7.72e-74
Family Sema domain 0.00000997
Further Details:      
 
Domain Number 2 Region: 546-596
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000126
Family TSP-1 type 1 repeat 0.00053
Further Details:      
 
Domain Number 3 Region: 494-545
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000981
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 4 Region: 622-663
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000262
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 5 Region: 441-477
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000471
Family Plexin repeat 0.0042
Further Details:      
 
Domain Number 6 Region: 735-777
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000127
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00021431001
Sequence length 1005
Comment pep supercontig:AMS_PRJEB1171_v1:HG380857:166765:170760:-1 gene:GSADVG00021431001 transcript:GSADVT00021431001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTEKLIISKTYNSFVDKGKERHHIALFHLINIIIFLRNSILRLSINDFHLLEKFQWKSS
TTDINTCRNQIQSHNECENYIRVLALRSRDQLLLTCGTNSYRPICTWRRPDSLSTIIPND
NFLSGDGKSPYNRKKKNEKLLNICFKGELYSATSNEPVFGVNDPLIQRSFTEGKQLRTQQ
HDSNWLRNPYFVRILNIGSYVYTFFREIALEHLSCGTTVYSRIARVCKHDDGTMKFSDTF
RSFSKLRLSCSKKIANEITSFDYNELQAIFFDRSTNLIYGAFNLPKSGLPGSAICIYTVD
QLERVFTSPYLTQKSNESYWLPSSSKHESEKCEPHQSSEIPIPSGPVLRSGVLQSSFDAL
VLENIRIGQLLIDRFNGITILFVITFDGLQLRKYSLINNNLCLLEQIQLKPSTLSENQWK
INQKEIVLTTTVSVLKFSVARCDRFNTSNLCLSAMDPYCTWDSNQQQCILYTKSSSTFTS
SSRSLTCPILNTTIDGGWTSWSSWFTCEQITGEKCQCRTRTCTQPMPQFGGRLCQGSNVE
ITRCEVHGGWSPWNEWSLCPKTCGKTIRTRTRTCTNPEPKNNGRLCIGSEREEESCPEIL
CSDESARLSSWKFIVYLLFRIDWETCSKSCGSGIQKRRRTCLLHGNKCTECLEETRLCNE
SPCPIQQVTLWSDWSQIVNPSNEGVYTEKRTRFICAIGTSFDKQLPEIKSDSIMYRICST
QGGNDYSLENLHFDDWSPWSAWSDCYPSCGIPSAVETRRRTCLGKRCVGNDIEKRECLSC
LSSSNNNWSCWTDWSDCSLCTSTRLRSIKTRTRTCLTNSCQGDSHEERLCSKCPLSSKSF
SIIDSFNENRFTLIHLILISLISFLLACFIMLCIFVLCRRRCRHQHYRHRQASNTFLHTD
DRDYFQASTSNSSSSPHTAQDSDTFTTLSTTNNHTSKFRSFDSSSSSTTTGGGGSGVSAF
LKEIPSRKLNMYINPREMPPLPPAATLKRTSLMSSMKTNLDADDL
Download sequence
Identical sequences GSADVT00021431001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]