SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00022158001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00022158001
Domain Number 1 Region: 1241-1530
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000065
Family Rhodopsin-like 0.017
Further Details:      
 
Domain Number 2 Region: 976-1018
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000349
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 561-595
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000223
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number 4 Region: 222-260
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000262
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00022158001
Sequence length 1538
Comment pep supercontig:AMS_PRJEB1171_v1:HG381735:9031:13701:1 gene:GSADVG00022158001 transcript:GSADVT00022158001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWLICIVGLLILFGQDVQGHSHLYYMDQTNNDGLYYDCLYYKVVNHTIQSFGIKDDLKT
WSQIIPYCIRPFSETEKVYNEGTKGEVLAIFTFQELRRQQVTISDLLSWSASIDLVELYD
EYLDVPSNASLRLQKFYNCSVPWFGRFCQYTFNISLSLNIIVNRTFTDKRFTNKSAITCY
LHLDCDRGPAPACLDWREICDRKVDCLGNGADEMNCFELEINECKENEYRCHNGICIPEE
FLGEGYFYSDCIDGTDENTLLAHRHTKCSKNPGYWCEESTHRKNRQNFVCGDGEITDDSN
LEGGRQCDNERNVIIKRSLFSYVEHSQLSYNCWFLLLCSMASNLYLNGDFNYYNIPKYTC
QTIFVIFPQRPIIHGHVLLVYLTNKTIFSSYGEISIFPDYVCYDVKKCPFLPSNSILNIN
GTTCRSTQELNLLTFTDIINLFQSCLIIIENEHEINHSRSILFQCPGTTKYISTHRVFDG
ISDCYKGTDEQDVDACQWNHKHRFKCSTEQKCISFILFQNGKKDCREGEDETTSISQQIT
FQNLCNGYVHLQPTMIDGFIETDETHCDNWPCNNLYTRCDGAWNCPNGIDELNCLPSACP
PDTHECISPITTKVICLPYHQAGNGIVDCLGSTDEREYCRLQKPERHQVRYKCWNDTSCV
YNIHVCLEGVCFIEEKIDCSPDIKYVLDRLNEDEKLKFPVYKYFMLDRLRTNLSSLMVKK
KDSIELISNSIVRLTADQENMAFNKKFTIKQTETCNRGILIYVGISLKIHCLCPPSYFGD
RCQYQSQRVSLTLQFSRKCTPTCYGVFGIIISLIDQDNIIHAYEQLTYLSTYECEKKFFT
YLLYQSRPKNITKKYIVRIDAYNKIKLTYYASWILPVQFLFLPVNRIPAHLIIPYHPVNS
FKNCPVFCDYGRCFAYINSPNEYFCLCNSGWSGINCTISYKSGCSADAKCLGKINNQSMC
LCPIEKYGSHCRLQSICQNRTCKNGGQCISENERVSRNSFICLCPIGFSGPTCETIQTKV
HISFIDIEIPRSLLVHFITVQTEYDPIRTTINAKIPFDQNKAIVEISILFHIIIAQISNE
YYLTYVNTNNTPSSVSIVQMKMEQRCLNVLKLFNNETVAKYSLLHRVKYYHLFCKNKSQL
KCFYDKEAFMCLCNEEGYANCFSFDFNIKYTCKRYGDCQNNAQCFSDRPNCPFSTFCVCE
DCFYGSKCQFTTKGFGLSLDAILGYQIKPHLSINHQPNIVKITIVLTIIMLVIGLVNSIL
STITFQRKTKNESGCRQYLLATSIVSLFSTFIFSIKLLMLILSQMSIITNIIILRISCVS
IDFLLRLIPIIIDWLNASVAIDRALSLIMSTKYDKNQSRRAVKWAIISILLFTMGSILHD
PINRQLIEDEEENRRWCLIQYSSSLQIYNSAINIFHFLVPFIINLVTAIIIIFVAARSRA
AAQQHQTYQQHLKEQFHRHNHLIVSSMILVIFATPRLIISFISGCMKSARNPALYLVGYF
ISFIPPSLTFLVFVVPSKSYTNEFYAATKRFRTLIGRQ
Download sequence
Identical sequences GSADVT00022158001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]