SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00022274001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00022274001
Domain Number 1 Region: 306-341
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000615
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 79-170
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000104
Family V set domains (antibody variable domain-like) 0.049
Further Details:      
 
Domain Number 3 Region: 214-279
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000162
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00022274001
Sequence length 458
Comment pep supercontig:AMS_PRJEB1171_v1:HG381751:6749:9184:-1 gene:GSADVG00022274001 transcript:GSADVT00022274001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVKIITSLVMFFCFIINISISEGASTHLDSKLRLKRQGDEMHEFTEDEEITREAIENET
QTNDTTVQSNAYSGVAFRVVVISPLLRVEPGKTVELNCFVYGGNSNTTIYWTQEEFKRHL
SPTELVSREEFTLGIMLRARITFDDRRKIGKYTCTAYDTNGIIDSATLTIQEVMDSHGTQ
STDPDAQVSACFAAPDSTGFRNDGTIQLIITAPDMEEGDFVELRCTGAMLENADSPTWYF
NGQRIYNVYPFHQNGTSLYIHPITRPYLGRYRCSTRLSIHRDGFIDLKFKDPVSTPSVTV
QEERNQCNADQVTCHNGQCIPRAFLCDGYNDCGDNSDEECELSTTTVLPTTTSEPEIVSF
CQITWIRSGDRYQPEAPHSMRVLTELKRLSFRVHSLSSSASTDGITVLDYLCEHTNEGMS
GNTVQDALRKVIQDSLISTSSRSFQSFDKSITLKWACG
Download sequence
Identical sequences GSADVT00022274001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]