SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00022630001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00022630001
Domain Number 1 Region: 8-65
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000721
Family Extended AAA-ATPase domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00022630001
Sequence length 241
Comment pep supercontig:AMS_PRJEB1171_v1:HG381774:8772:9629:-1 gene:GSADVG00022630001 transcript:GSADVT00022630001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRWILHHYYRTQRAKCLVLVGPTSTGKTSFALSLPGRVNYFQEHWNLDVWSDSARYSVY
DDVPWDKFEVLNYPNKKNLLTQKQYTIQATDKYRHKKEINVSQPAIVLLNPEDAGSLLAE
PITDAEKQTTDYWKERAFVYVMGPDEYFFKQQSKTMQSTTTKNQTTSNNSSMSSSEERFS
DSQDFQRMYQCYDETHKKSFKKNFISNHSDFFLMFLSTYHYLFIPEKHYSLLFFLQTNSF
D
Download sequence
Identical sequences GSADVT00022630001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]