SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00022692001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00022692001
Domain Number 1 Region: 1199-1493
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000011
Family Rhodopsin-like 0.02
Further Details:      
 
Domain Number 2 Region: 927-974
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000242
Family EGF-type module 0.018
Further Details:      
 
Domain Number 3 Region: 167-206
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000105
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 4 Region: 706-741
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000641
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00022692001
Sequence length 1499
Comment pep supercontig:AMS_PRJEB1171_v1:HG381782:5624:10201:1 gene:GSADVG00022692001 transcript:GSADVT00022692001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGINYVQNYHLIPYCRRPDNNEEQDETQYPIRENIIQTLSFEQLKRQSVTSEQLLRWFSA
IDVAEDYERFFNDSDVFHNCSSPWFGSMCQYKFPFEQNLSLEDIIQITFKKQDDIRANIF
HGTCYRFLTNCNGRSWPLCLDWHNICDGKFDCMNGDDEGFCDQLELTKCNDDEYRCHFGG
QCIPQTFLKDGRFSIDCLDGSDESDRRFLGIASTNAGCTPVPSFRCQERIGRYFGSFQLS
LSLLTNMEHISNIDCQKTFYCALHANRTFGYGDIVGSGMELFPILEDIRDEDCEPLSKYC
ESEWLVIPVTPILFGFFQFVYFTNRSVNDFRASMEPDLICFHEQACPALLMNIVPTHYIN
GLTCFPPLNFSLFYEWNDFNDVFSIFSDYNRYCRKKGTETFCTNLSDFYCNKSMKCISYN
RIGDGQSDCYYGEDEQFNACHLNDSNRFQCLSDPTKCLLQIAVGDGIYDCHGEEDEIFAY
SQDLFVLLPYPYMCNIVPNTFILMYERNETDETNCHWWPCDNPYTHCDEHWNCPNGIDEL
NCPNSRCSYNKHDCSVQQSESFYCISLTNMYDKYLNSCNETYIKRNVYFYNETNDISEDY
VSWNDNKCVTFDQLCPPNSPLDISFFEENICLYSSEHLYWMLDKIVKLIPNDEYLCTFHS
ALSGIIPPYFKTSRLGYYPSLSINHSNSLLPQANSTSRLTSNMDNESISYCNRGILVLHG
SNQTKTCFCPPNYFGSRCQWQNQRISLTIQLVWRSMTFQMTIFELIIMLIDEHGQIEAYY
ERITYMPDRDCNTKYNLYLLYPDRPKSILRNYSIRIDIYEKINVIYWLSWYLPIPFQFLP
VNRIATQIRIPELPNHESCTLSCGEHGKCMNYINNKSLSFCLCNDGYSSTDCNIKHQCHC
ADDSFCLTSTICICPLNKFGSYCHLKHSSCQTKTNNSCEHNGVCIPVDDRISLTEFTCFC
PEDYSGKRCEIENTRIDIYLNEEIRSITSLVLIHFITSFNHGEHERRTLLRKISFNQKIL
TVYNTKSFHILFVQIPNKYYYLTILREVFHPSEHIRTEIQLKKRCFSIDQLILNETFQQY
EYLRRVKYYPLLCRKNLELECFHDHEQMCLCDQDRFANCFLFNHTINNDCPGYNYCENQG
QCFQNNATCPTKLTCICRDCYYGGKCQFSTRGFIFSLDTILAYHIKPKISLTEQSLVVKI
SIVISTILLLIGIINGLLAFVTFRRIKVKQMGSGYYLLFSSIFSIFTIITLTYKFWLLIL
SQTSFITNQSLLYFNCITIDVLLRILLASSEWCNCCVSIERMFSVIMATRFQRKKSVKFS
KRIILIVFILVTLTHIHEPPHRQLIDDFDIDEHRIWCFVRYSSLIENYNSFIILFHFLTP
FSINIISSLWMIIQLAYRRRGVERGQTVQHHLKHQIQQHQHLLYSPLILILLSLPRLIIS
FTRTCMRSTQQPWLFLIGYFLSFVPSMSIFVVFVLPSKTYKTEFNAVIEKIFKKFRTPQ
Download sequence
Identical sequences GSADVT00022692001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]