SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00026304001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00026304001
Domain Number 1 Region: 1150-1452
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 7.14e-21
Family Rhodopsin-like 0.016
Further Details:      
 
Domain Number 2 Region: 484-525
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000376
Family LDL receptor-like module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00026304001
Sequence length 1458
Comment pep supercontig:AMS_PRJEB1171_v1:HG380861:60934:65424:-1 gene:GSADVG00026304001 transcript:GSADVT00026304001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLQKTITTILITFCTDLQSIQSYFDYSHEKQLHNDYDYLFSYVSNDIVEYVLPYILRH
QIIEYCVRPDSTNYEINDDLKTDIISNNKETRQTTYLSSFPSCYKHLDCGDVCLDWRQIC
DGIIDCINSGQDEENCSQLEMNECHITNEYRCHNGMHCIPIDFLHDDALNPDCIDRSDET
HLYSDYPDNCILDMAFRCDEHICRPSQSENIPCVLLEESLIKQLMMSKINETCLRAMICM
IDKTLDECQRTFLKVSSCNHTIQRYCPLIPFAFPSSAILFDHIYFVYESKSMNFISTSLV
LPNYICFNQYLCNHLIRVRPVINISDEIVCQDFIKDLKWPSFFSDWFELISYVKTKFQIC
STIYVDPLHCQINSTFFYHCKNSTKCISKHRLMDGIQDCVLNDDEKIRNSCKLDDQHLRF
QCSNHIGKVSKCLALITVQNQINDCDDGKDEIDYLDKINQQNIPFATVCDGFIDLIDPDN
TETDETYCDWWQCNNIYTQCDGVWNCRNGADELNCSYLPVRCPSMHHLCVSPYTFKAICL
PLDMAGNGQTDCVGGTDERHLCRFNGRLFTPFRCRNDTNCLELYEVCDGEESCNYTDDET
FCSKNSFWGSEDICMPSENYQRTLEKKIICLLNLEQYRRQDIFFALEPRIVLNRPIKKST
IEKQKQTINLFRCNRGKVVQDGNGQLKCLCSPAYYGSDCQYQNQRVSLTLQIRAELDWHT
VFLLAIFLVDDNQQIESYDYIEYLSVRDCLTKFDIYLLYSSRPKDSSKNYSVRIDVYDKI
LLTYRTSWLFPLKFSFLPVHRLAIQFIIPLNPSRAKLCSQKCEHGQCILFENYHSSHIDD
FCLCDRGWSGRYCTTKHDRCQCSSNSVCIGDGSFCLCPLNKYGIDCLHNHSSCQQNTCQH
NGKCIGTDIRMLSNKNSKIEKYKCLCSEGYSEKTCKYTDPKIYITFHSDISIPPYIFAHF
ITILSDSIPDRLTMFKKISLDRDEVILYIPQKFHFVFIEFSKKYYLTIIQKEFKPFTNLS
TQIISSHRCRNISELFNSSILQLDLLLRVKLYHLPCQEDFKLLCFYDHNYMCLCDSERRQ
ANCFEFDHNIIYNCRSGKICQNNAQCFQDDSSCPKTYICACAECYYGTRCHLSTKGFELS
IDGILGYQIRPNLSLWQQPFVVKFSIIIVTIMLTFSFISNSLSLLTFWIKETREIGCGLY
LLVNSITSLLTMIVFTIKFVILLLTHMSVINNRILLRYSCISINLMLSNLLNSTGWLSTC
VAVERFIIVVKGINFHRNASKKLAKLMILIVILFCNLTVMHDPLHRHLFDDLDENRIWCV
VSYPSSLNIYNSFINTFHFLGPFTINFLSTIMILIIITYRKRYVDRNQLSYKQYFWKQLR
RYQHIFLSQCFLVLLVLPRLIVIFISGCMKSARDPWLFLAGYFISFLPPMLHFFVFVLPS
KEYRKAFQQSIEQLRMLC
Download sequence
Identical sequences GSADVT00026304001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]