SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00026954001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00026954001
Domain Number 1 Region: 57-144
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000981
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 
Domain Number 2 Region: 157-192
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000102
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00026954001
Sequence length 195
Comment pep supercontig:AMS_PRJEB1171_v1:HG380865:247496:248251:-1 gene:GSADVG00026954001 transcript:GSADVT00026954001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTMFRLQILILTYLTVTIHAGKSLEKYYMDKMCGSDSLVLDGDNKPGISFQLTTNNKYK
PNMDCTVKFRTAQPTQRLIITVEKMDITDCSGDSLLIYDGTTLMNKNPKQQCGSPGLYTF
TSSSTQVSMVFKSNTAIESSGFQIAVALHFPMIASCPQSLGFYQCKNRNCISKQLQCDGR
NHCGDGTDENQCSIG
Download sequence
Identical sequences GSADVT00026954001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]