SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00027182001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00027182001
Domain Number 1 Region: 5-49
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.000000000602
Family AN1-like Zinc finger 0.0022
Further Details:      
 
Domain Number 2 Region: 63-113
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0000000051
Family AN1-like Zinc finger 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00027182001
Sequence length 245
Comment pep supercontig:AMS_PRJEB1171_v1:HG380867:108438:109175:1 gene:GSADVG00027182001 transcript:GSADVT00027182001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVELLGTHCEYPQCNTLDFLPVHCIYCSKTFCKRHGSAPDHSCISLQQTDSITSSNSSSF
LPCAYTQGCKSQKSPISFTCPLCLKNFCVEHRHFDDHECSHRSQQQPSTHYTSQTNKNEP
KAASNYPTEKFIGTKNEALANKVTMMKLKQTAKGPTGVPMENRLHVFVQIADDDDNENKK
RYPFYLSKLWPLGKGLDYLTKELKLLPANRIIILERDQIPLDLSTTISDLKDFHDADVII
LKKVK
Download sequence
Identical sequences GSADVT00027182001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]