SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00027189001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00027189001
Domain Number 1 Region: 1-156
Classification Level Classification E-value
Superfamily IpsF-like 7.06e-54
Family IpsF-like 0.0000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00027189001
Sequence length 157
Comment pep supercontig:AMS_PRJEB1171_v1:HG380867:128663:129136:1 gene:GSADVG00027189001 transcript:GSADVT00027189001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFDAHRFLPTKNGPSNKIMLCGVAISSEYDVEANSDGDVGIHALVDALLGSIAAGDIGM
HFTPNDPQWMGAKSDIFLKHALKLVQEKGGEIVNIDITIIGEKPHVSPHRNIMRKTLSEL
LTLDMDRVSVKATTTEKMGFTGREEGIAAQAIVSVLV
Download sequence
Identical sequences GSADVT00027189001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]