SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00027527001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00027527001
Domain Number 1 Region: 1000-1044
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000544
Family EGF-type module 0.018
Further Details:      
 
Domain Number 2 Region: 1262-1568
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000156
Family Rhodopsin-like 0.02
Further Details:      
 
Domain Number 3 Region: 178-219
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000227
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 4 Region: 222-259
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000393
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 5 Region: 581-616
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000438
Family LDL receptor-like module 0.0038
Further Details:      
 
Domain Number 6 Region: 776-809
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000489
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00027527001
Sequence length 1581
Comment pep supercontig:AMS_PRJEB1171_v1:HG380869:304276:309021:-1 gene:GSADVG00027527001 transcript:GSADVT00027527001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLYLFIFIILCKVFNTHYSVYHSDQSLSTNFGFDCLYGHLTDNEEYEDIRSDTTYHLI
SYCRRPIEHDDDENEKESILSTENIYNNITFTELYQYGVTTEQLLNWSAPIDLVEQYAMK
DNTDRIHIFYNCSLPWFGPKCQYKFDNNAFLSFNEILRLNFLTRIRITNTLPDFDIDTCY
PFLINCSYKLPFMCLDWREICDGKYDCMNGEDEQNCETMEIFECPENTYRCHYGGQCIPL
TFVRDKHSHIDCLDGTDETVVIEQENALFGAFCYTIPTFQCEEHMSRYQFSFQCGDGYYY
PYHLNTRTKMSCANGRFLKLKLSRNDSFSNISKQSWKELLESTLISNMHIWYRTLTNSNS
MYTLLSCKSTNRICLSNWFFKVQLFNTHPMFHFIYLSNRSFSDFYHYVQPNYICFYPQDC
LPLVKDAIDIGLNNGLICYYTNDISEESITNETQIRKVLDKLFLRCVTTGIERTCSHSSL
FHCPISLKCISKHRLVDGISDCYYNEDELFDSCQLNDSQRFICSSEPNKCLAPIALYNRK
YECQGKEDEMDEIQRNILKGYVPIGLICDGVKEQLLEHANDTDETNCEYWPCNNPYTRCN
GVSTCLDGTDELNCPLLEYSINTGQCSKQIVTNLFCERAIHSIANKFDSKIVHVTNNTVL
DYATNKNRTKCFITPKCYSLPQICQFDILNTLFDQLCHLPEALVCLLELFYWKPILRTNI
CHFNLYTSSKDDQVQSAFTSTQLGYFPIVSSALSNSNNSNMKTTTNIETLTKTFKNWYCN
RGILVFHKNNQTKTCLCPPTYFGHRCQWQNQRLSLTFQFIYQTNTYNTILIFQLIIMLID
QQKHMTSYHEQILYIPKENCDTKYNIYLLYPTRPKNLSINYTIHIDIFDKVTLTYYGSWF
LSIPFQFLPVNRIATQIFIPTTPKMISKSCPLVCGHHGQCVEYLNQNNSYFCQCHQGYSG
LHCHIPHHCSCSSDSLCLSSSICVCPVNKFGSKCYLNHSICQQSTNPCQNHGFCVPVDDR
MGLKKFFCLCPDGFSGRTCEHHQNRLDIRFDPKKITMTPFIYVHSIRALKNDNHQYTTIL
KKVHPEQNLLTIYVKFPFHLIFIELFDHTFYLAVLREKFLESEHIQTNIVFNQRCVHISE
LMNELFLDYSFLHRVKYYPLLCQENLHLMCFYDEKQMCTCDRSRFSNCFTFNIPSLSYDC
QGRNICENNGLCLQDNPACPTQSICVCRQCFYGTKCQFSMKGFVSSLDYILGYHIIPNRS
INQQSFIIKMTIVIITIMFCLGLLNGFLSIVTYRIKEIKCIGCGSYLLVSSWNSMFLIIM
LEVKCWHLLLSQMSVLNNRSYLKFTCLSLDVILNVLIATNDWFGGCISIEQVFNTFKGVN
FNQNRSKKLAKRIIFGIYILTILTNIHDPFYRQLIDDIDIDERRTWCIVQYSPTIDTYNT
IVTFFHFLMPLSINFLSTFIVIFLMAQSRSTTRSQITFNANLREQFHQHKHNLIATCALF
FLALPRLIISFVSRCMKSSQDPSLFLIGYLISFIPSMMTFFVFIMSADGYKEEFYASVRR
FFTRIHRMRVGVLVNVMNFMF
Download sequence
Identical sequences GSADVT00027527001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]